Skip to content

Instantly share code, notes, and snippets.

@stain
Last active October 11, 2022 12:51
Show Gist options
  • Select an option

  • Save stain/a7143d5276b927571a68f493cd388836 to your computer and use it in GitHub Desktop.

Select an option

Save stain/a7143d5276b927571a68f493cd388836 to your computer and use it in GitHub Desktop.
{
"@context": "https://w3id.org/ro/crate/1.1/context",
"@graph": [
{
"@type": "CreativeWork",
"@id": "ro-crate-metadata.json",
"conformsTo": {"@id": "https://w3id.org/ro/crate/1.1"},
"about": {"@id": "https://disprot.org/#2021-08"}
},
{
"@id": "https://disprot.org/#2021-08",
"@type": "Dataset",
"conformsTo": {
"@id": "https://bioschemas.org/profiles/Dataset/0.3-RELEASE-2019_06_14"
},
"creator": {
"@id": "https://biocomputingup.it/#Organization"
},
"dateModified": "2021-08",
"description": "DisProt is a database of intrinsically disordered proteins. Disordered regions are manually curated from literature. DisProt annotations cover both structural and functional aspects of disorder detected by specific experimental methods. Annotation concepts and detection methods are encoded in the Disorder Ontology.",
"identifier": "https://disprot.org/#2020-12",
"includedInDataCatalog": {
"@id": "https://disprot.org/#DataCatalog"
},
"keywords": [
"DisProt",
"IDP",
"IDPs",
"intrinsic protein disorder",
"protein annotation",
"protein disorder",
"manually curated"
],
"license": {
"@id": "https://creativecommons.org/licenses/by/4.0"
},
"name": "DisProt",
"url": {
"@id": "https://disprot.org"
},
"version": "8.3",
"mentions": [
{"@id": "https://disprot.org/DP00003"},
{"@id": "https://disprot.org/DP00004"},
{"@id": "https://disprot.org/DP00005"}
]
},
{
"@id": "https://disprot.org/#DataCatalog",
"@type": "DataCatalog",
"conformsTo": {
"@id": "https://bioschemas.org/profiles/DataCatalog/0.3-RELEASE-2019_07_01"
},
"citation": {
"@id": "https://doi.org/10.1093/nar/gkz975"
},
"dataset": {
"@id": "https://disprot.org/#2021-08"
},
"dateModified": "2021-08",
"datePublished": "2019-09",
"description": "DisProt is a database of intrinsically disordered proteins. Disordered regions are manually curated from literature. DisProt annotations cover both structural and functional aspects of disorder detected by specific experimental methods. Annotation concepts and detection methods are encoded in the Disorder Ontology.",
"encodingFormat": [
"text/html",
"application/json"
],
"identifier": "https://registry.identifiers.org/registry/disprot",
"keywords": [
"DisProt",
"IDP",
"IDPs",
"intrinsic protein disorder",
"protein annotation",
"protein disorder"
],
"license": {
"@id": "https://creativecommons.org/licenses/by/4.0"
},
"name": "DisProt, The database of intrinsically disordered proteins",
"provider": {
"@id": "https://bioschemas.org/crawl/v1/disprot/disprot/20210907/1/disprot.org/1195803267"
},
"sameAs": {
"@id": "https://registry.identifiers.org/registry/disprot"
},
"sourceOrganization": {
"@id": "https://biocomputingup.it/#Organization"
},
"url": {
"@id": "https://disprot.org"
}
},
{
"@id": "https://biocomputingup.it/#Organization",
"@type": "Organization",
"conformsTo": {
"@id": "https://bioschemas.org/profiles/Organization/0.2-DRAFT-2019_07_19"
},
"description": "University of Padua, Department of Biomedical Sciences, BioComputing UP laboratory",
"legalName": "University of Padua",
"name": "BioComputing UP, Department of Biomedical Sciences, University of Padua",
"sameAs": {
"@id": "https://biocomputingup.it"
}
},
{
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00003/20210907/1/disprot.org/DP00003/1343757371",
"@type": "schema:SequenceRange",
"schema:rangeEnd": "334",
"schema:rangeStart": "294"
},
{
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00003/20210907/1/disprot.org/DP00003/1439209021",
"@type": "schema:SequenceRange",
"schema:rangeEnd": "464",
"schema:rangeStart": "454"
},
{
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00003/20210907/1/disprot.org/DP00003/1748786242",
"@type": "PropertyValue",
"name": "Protein disorder content",
"propertyID": {
"@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00499"
},
"value": "9.829867674858223E-2"
},
{
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00003/20210907/1/disprot.org/DP00003/1881427155",
"@type": "DefinedTermSet",
"name": "NCBI taxon",
"url": {
"@id": "https://bioportal.bioontology.org/ontologies/NCBITAXON"
}
},
{
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00003/20210907/1/disprot.org/DP00003/1896912531",
"@type": "DefinedTerm",
"inDefinedTermSet": {
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00003/20210907/1/disprot.org/DP00003/1881427155"
},
"sameAs": [
{
"@id": "http://purl.uniprot.org/taxonomy/28285"
},
{
"@id": "https://identifiers.org/taxonomy:28285"
},
{
"@id": "http://purl.obolibrary.org/obo/NCBITaxon_28285"
}
],
"termCode": "28285",
"url": {
"@id": "http://purl.bioontology.org/ontology/NCBITAXON/28285"
}
},
{
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00003/20210907/1/disprot.org/DP00003/1941496935",
"@type": "schema:SequenceRange",
"schema:rangeEnd": "529",
"schema:rangeStart": "1"
},
{
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00003/20210907/1/disprot.org/DP00003/358568134",
"@type": "PropertyValue",
"name": "Term",
"value": {
"@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00076"
}
},
{
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00003/20210907/1/disprot.org/DP00003/882439562",
"@type": "PropertyValue",
"name": "Term",
"value": {
"@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00076"
}
},
{
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00004/20210907/2/disprot.org/DP00004/1619892227",
"@type": "PropertyValue",
"name": "Term",
"value": {
"@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00076"
}
},
{
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00004/20210907/2/disprot.org/DP00004/1655452007",
"@type": "PropertyValue",
"name": "Protein disorder content",
"propertyID": {
"@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00499"
},
"value": "2.1764705882352942E-1"
},
{
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00004/20210907/2/disprot.org/DP00004/1820736838",
"@type": "PropertyValue",
"name": "Term",
"value": {
"@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00510"
}
},
{
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00004/20210907/2/disprot.org/DP00004/2045537157",
"@type": "schema:SequenceRange",
"schema:rangeEnd": "170",
"schema:rangeStart": "134"
},
{
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00004/20210907/2/disprot.org/DP00004/2105325746",
"@type": "DefinedTermSet",
"name": "NCBI taxon",
"url": {
"@id": "https://bioportal.bioontology.org/ontologies/NCBITAXON"
}
},
{
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00004/20210907/2/disprot.org/DP00004/271345528",
"@type": "DefinedTerm",
"inDefinedTermSet": {
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00004/20210907/2/disprot.org/DP00004/2105325746"
},
"sameAs": [
{
"@id": "http://purl.uniprot.org/taxonomy/9606"
},
{
"@id": "https://identifiers.org/taxonomy:9606"
},
{
"@id": "http://purl.obolibrary.org/obo/NCBITaxon_9606"
}
],
"termCode": "9606",
"url": {
"@id": "http://purl.bioontology.org/ontology/NCBITAXON/9606"
}
},
{
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00004/20210907/2/disprot.org/DP00004/480974100",
"@type": "schema:SequenceRange",
"schema:rangeEnd": "170",
"schema:rangeStart": "134"
},
{
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00004/20210907/2/disprot.org/DP00004/499355226",
"@type": "PropertyValue",
"name": "Term",
"value": {
"@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00050"
}
},
{
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00004/20210907/2/disprot.org/DP00004/960742943",
"@type": "schema:SequenceRange",
"schema:rangeEnd": "170",
"schema:rangeStart": "1"
},
{
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00004/20210907/2/disprot.org/DP00004/98832210",
"@type": "schema:SequenceRange",
"schema:rangeEnd": "170",
"schema:rangeStart": "134"
},
{
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/1009444519",
"@type": "PropertyValue",
"name": "Term",
"value": {
"@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00076"
}
},
{
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/1077537019",
"@type": "schema:SequenceRange",
"schema:rangeEnd": "47",
"schema:rangeStart": "34"
},
{
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/1199537498",
"@type": "PropertyValue",
"name": "Term",
"value": {
"@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00063"
}
},
{
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/1257796954",
"@type": "PropertyValue",
"name": "Term",
"value": {
"@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00076"
}
},
{
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/1271382721",
"@type": "schema:SequenceRange",
"schema:rangeEnd": "107",
"schema:rangeStart": "1"
},
{
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/1413740343",
"@type": "PropertyValue",
"name": "Term",
"value": {
"@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00050"
}
},
{
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/1535211358",
"@type": "PropertyValue",
"name": "Term",
"value": {
"@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00511"
}
},
{
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/1557472421",
"@type": "DefinedTermSet",
"name": "NCBI taxon",
"url": {
"@id": "https://bioportal.bioontology.org/ontologies/NCBITAXON"
}
},
{
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/1603435240",
"@type": "PropertyValue",
"name": "Term",
"value": {
"@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00050"
}
},
{
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/1666891346",
"@type": "PropertyValue",
"name": "Term",
"value": {
"@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00076"
}
},
{
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/1682055931",
"@type": "PropertyValue",
"name": "Term",
"value": {
"@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00066"
}
},
{
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/1786460745",
"@type": "schema:SequenceRange",
"schema:rangeEnd": "107",
"schema:rangeStart": "1"
},
{
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/1895124567",
"@type": "DefinedTerm",
"inDefinedTermSet": {
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/1557472421"
},
"sameAs": [
{
"@id": "http://purl.uniprot.org/taxonomy/10710"
},
{
"@id": "https://identifiers.org/taxonomy:10710"
},
{
"@id": "http://purl.obolibrary.org/obo/NCBITaxon_10710"
}
],
"termCode": "10710",
"url": {
"@id": "http://purl.bioontology.org/ontology/NCBITAXON/10710"
}
},
{
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/1906093950",
"@type": "schema:SequenceRange",
"schema:rangeEnd": "107",
"schema:rangeStart": "1"
},
{
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/2005379000",
"@type": "schema:SequenceRange",
"schema:rangeEnd": "107",
"schema:rangeStart": "1"
},
{
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/2011680892",
"@type": "PropertyValue",
"name": "Term",
"value": {
"@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00510"
}
},
{
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/2079549948",
"@type": "schema:SequenceRange",
"schema:rangeEnd": "36",
"schema:rangeStart": "1"
},
{
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/2145892216",
"@type": "schema:SequenceRange",
"schema:rangeEnd": "47",
"schema:rangeStart": "34"
},
{
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/235465215",
"@type": "schema:SequenceRange",
"schema:rangeEnd": "107",
"schema:rangeStart": "1"
},
{
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/313846963",
"@type": "schema:SequenceRange",
"schema:rangeEnd": "107",
"schema:rangeStart": "1"
},
{
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/339817883",
"@type": "schema:SequenceRange",
"schema:rangeEnd": "107",
"schema:rangeStart": "1"
},
{
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/346339967",
"@type": "PropertyValue",
"name": "Term",
"value": {
"@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00076"
}
},
{
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/37194791",
"@type": "PropertyValue",
"name": "Term",
"value": {
"@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00076"
}
},
{
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/422739231",
"@type": "PropertyValue",
"name": "Term",
"value": {
"@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00517"
}
},
{
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/524863385",
"@type": "schema:SequenceRange",
"schema:rangeEnd": "22",
"schema:rangeStart": "1"
},
{
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/550065185",
"@type": "schema:SequenceRange",
"schema:rangeEnd": "22",
"schema:rangeStart": "1"
},
{
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/594029466",
"@type": "PropertyValue",
"name": "Term",
"value": {
"@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00511"
}
},
{
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/622723804",
"@type": "PropertyValue",
"name": "Term",
"value": {
"@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00510"
}
},
{
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/652441487",
"@type": "PropertyValue",
"name": "Term",
"value": {
"@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00063"
}
},
{
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/661824365",
"@type": "schema:SequenceRange",
"schema:rangeEnd": "107",
"schema:rangeStart": "1"
},
{
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/679459059",
"@type": "schema:SequenceRange",
"schema:rangeEnd": "107",
"schema:rangeStart": "1"
},
{
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/726966167",
"@type": "schema:SequenceRange",
"schema:rangeEnd": "107",
"schema:rangeStart": "1"
},
{
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/851963025",
"@type": "PropertyValue",
"name": "Term",
"value": {
"@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00066"
}
},
{
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/868802206",
"@type": "schema:SequenceRange",
"schema:rangeEnd": "22",
"schema:rangeStart": "1"
},
{
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/924391138",
"@type": "PropertyValue",
"name": "Protein disorder content",
"propertyID": {
"@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00499"
},
"value": "1"
},
{
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/945847033",
"@type": "schema:SequenceRange",
"schema:rangeEnd": "107",
"schema:rangeStart": "1"
},
{
"@id": "https://bioschemas.org/crawl/v1/disprot/disprot/20210907/1/disprot.org/1195803267",
"@type": "Person",
"email": "silvio.tosatto@unipd.it",
"familyName": "Tosatto",
"givenName": "Silvio",
"identifier": "https://orcid.org/0000-0003-4525-7793",
"name": "Silvio Tosatto",
"url": {
"@id": "https://biocomputingup.it/people/silvio"
}
},
{
"@id": "https://bioschemas.org/profiles/DataCatalog/0.3-RELEASE-2019_07_01",
"@type": "CreativeWork"
},
{
"@id": "https://bioschemas.org/profiles/Dataset/0.3-RELEASE-2019_06_14",
"@type": "CreativeWork"
},
{
"@id": "https://bioschemas.org/profiles/Organization/0.2-DRAFT-2019_07_19",
"@type": "CreativeWork"
},
{
"@id": "https://bioschemas.org/profiles/Protein/0.11-RELEASE",
"@type": "CreativeWork"
},
{
"@id": "https://creativecommons.org/licensEs/by/4.0/",
"@type": "CreativeWork",
"name": "Creative Commons CC4 Attribution",
"url": {
"@id": "https://creativecommons.org/licenses/by/4.0"
}
},
{
"@id": "https://disprot.org",
"dct:title": "DisProt"
},
{
"@id": "https://disprot.org/DP00003",
"@type": "schema:Protein",
"conformsTo": {
"@id": "https://bioschemas.org/profiles/Protein/0.11-RELEASE"
},
"dct:title": "DisProt",
"schema:hasBioPolymerSequence": "MASREEEQRETTPERGRGAARRPPTMEDVSSPSPSPPPPRAPPKKRMRRRIESEDEEDSSQDALVPRTPSPRPSTSAADLAIAPKKKKKRPSPKPERPPSPEVIVDSEEEREDVALQMVGFSNPPVLIKHGKGGKRTVRRLNEDDPVARGMRTQEEEEEPSEAESEITVMNPLSVPIVSAWEKGMEAARALMDKYHVDNDLKANFKLLPDQVEALAAVCKTWLNEEHRGLQLTFTSKKTFVTMMGRFLQAYLQSFAEVTYKHHEPTGCALWLHRCAEIEGELKCLHGSIMINKEHVIEMDVTSENGQRALKEQSSKAKIVKNRWGRNVVQISNTDARCCVHDAACPANQFSGKSCGMFFSEGAKAQVAFKQIKAFMQALYPNAQTGHGHLLMPLRCECNSKPGHAPFLGRQLPKLTPFALSNAEDLDADLISDKSVLASVHHPALIVFQCCNPVYRNSRAQGGGPNCDFKISAPDLLNALVMVRSLWSENFTELPRMVVPEFKWSTKHQYRNVSLPVAHSDARQNPFDF",
"schema:hasSequenceAnnotation": [
{
"@id": "https://disprot.org/DP00003#disorder-content"
},
{
"@id": "https://disprot.org/DP00003r002"
},
{
"@id": "https://disprot.org/DP00003r004"
}
],
"identifier": "https://identifiers.org/disprot:DP00003",
"schema:includedInDataset": "https://disprot.org/#2021-08",
"name": "DNA-binding protein",
"sameAs": {
"@id": "http://purl.uniprot.org/uniprot/P03265"
},
"schema:taxonomicRange": {
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00003/20210907/1/disprot.org/DP00003/1896912531"
}
},
{
"@id": "https://disprot.org/DP00003#disorder-content",
"@type": "schema:SequenceAnnotation",
"additionalProperty": {
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00003/20210907/1/disprot.org/DP00003/1748786242"
},
"schema:sequenceLocation": {
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00003/20210907/1/disprot.org/DP00003/1941496935"
}
},
{
"@id": "https://disprot.org/DP00003r002",
"@type": "schema:SequenceAnnotation",
"additionalProperty": {
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00003/20210907/1/disprot.org/DP00003/358568134"
},
"schema:sequenceLocation": {
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00003/20210907/1/disprot.org/DP00003/1343757371"
},
"subjectOf": {
"@id": "https://identifiers.org/pubmed:8632448"
}
},
{
"@id": "https://disprot.org/DP00003r004",
"@type": "schema:SequenceAnnotation",
"additionalProperty": {
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00003/20210907/1/disprot.org/DP00003/882439562"
},
"schema:sequenceLocation": {
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00003/20210907/1/disprot.org/DP00003/1439209021"
},
"subjectOf": {
"@id": "https://identifiers.org/pubmed:8632448"
}
},
{
"@id": "https://disprot.org/DP00004",
"@type": "schema:Protein",
"conformsTo": {
"@id": "https://bioschemas.org/profiles/Protein/0.11-RELEASE"
},
"dct:title": "DisProt",
"schema:hasBioPolymerSequence": "MKTQRDGHSLGRWSLVLLLLGLVMPLAIIAQVLSYKEAVLRAIDGINQRSSDANLYRLLDLDPRPTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES",
"schema:hasSequenceAnnotation": [
{
"@id": "https://disprot.org/DP00004#disorder-content"
},
{
"@id": "https://disprot.org/DP00004r001"
},
{
"@id": "https://disprot.org/DP00004r002"
},
{
"@id": "https://disprot.org/DP00004r004"
}
],
"identifier": "https://identifiers.org/disprot:DP00004",
"schema:includedInDataset": "https://disprot.org/#2021-08",
"name": "Cathelicidin antimicrobial peptide",
"sameAs": {
"@id": "http://purl.uniprot.org/uniprot/P49913"
},
"schema:taxonomicRange": {
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00004/20210907/2/disprot.org/DP00004/271345528"
}
},
{
"@id": "https://disprot.org/DP00004#disorder-content",
"@type": "schema:SequenceAnnotation",
"additionalProperty": {
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00004/20210907/2/disprot.org/DP00004/1655452007"
},
"schema:sequenceLocation": {
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00004/20210907/2/disprot.org/DP00004/960742943"
}
},
{
"@id": "https://disprot.org/DP00004r001",
"@type": "schema:SequenceAnnotation",
"additionalProperty": {
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00004/20210907/2/disprot.org/DP00004/1619892227"
},
"schema:sequenceLocation": {
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00004/20210907/2/disprot.org/DP00004/480974100"
},
"subjectOf": {
"@id": "https://identifiers.org/pubmed:9452503"
}
},
{
"@id": "https://disprot.org/DP00004r002",
"@type": "schema:SequenceAnnotation",
"additionalProperty": {
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00004/20210907/2/disprot.org/DP00004/499355226"
},
"schema:sequenceLocation": {
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00004/20210907/2/disprot.org/DP00004/2045537157"
},
"subjectOf": {
"@id": "https://identifiers.org/pubmed:9452503"
}
},
{
"@id": "https://disprot.org/DP00004r004",
"@type": "schema:SequenceAnnotation",
"additionalProperty": {
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00004/20210907/2/disprot.org/DP00004/1820736838"
},
"schema:sequenceLocation": {
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00004/20210907/2/disprot.org/DP00004/98832210"
},
"subjectOf": {
"@id": "https://identifiers.org/pubmed:9452503"
}
},
{
"@id": "https://disprot.org/DP00005",
"@type": "schema:Protein",
"conformsTo": {
"@id": "https://bioschemas.org/profiles/Protein/0.11-RELEASE"
},
"dct:title": "DisProt",
"schema:hasBioPolymerSequence": "MDAQTRRRERRAEKQAQWKAANPLLVGVSAKPVNRPILSLNRKPKSRVESALNPIDLTVLAEYHKQIESNLQRIERKNQRTWYSKPGERGITCSGRQKIKGKSIPLI",
"schema:hasSequenceAnnotation": [
{
"@id": "https://disprot.org/DP00005#disorder-content"
},
{
"@id": "https://disprot.org/DP00005r001"
},
{
"@id": "https://disprot.org/DP00005r004"
},
{
"@id": "https://disprot.org/DP00005r005"
},
{
"@id": "https://disprot.org/DP00005r006"
},
{
"@id": "https://disprot.org/DP00005r007"
},
{
"@id": "https://disprot.org/DP00005r008"
},
{
"@id": "https://disprot.org/DP00005r009"
},
{
"@id": "https://disprot.org/DP00005r010"
},
{
"@id": "https://disprot.org/DP00005r011"
},
{
"@id": "https://disprot.org/DP00005r012"
},
{
"@id": "https://disprot.org/DP00005r013"
},
{
"@id": "https://disprot.org/DP00005r014"
},
{
"@id": "https://disprot.org/DP00005r015"
},
{
"@id": "https://disprot.org/DP00005r016"
},
{
"@id": "https://disprot.org/DP00005r017"
},
{
"@id": "https://disprot.org/DP00005r018"
}
],
"identifier": "https://identifiers.org/disprot:DP00005",
"schema:includedInDataset": "https://disprot.org/#2021-08",
"name": "Antitermination protein N",
"sameAs": {
"@id": "http://purl.uniprot.org/uniprot/P03045"
},
"schema:taxonomicRange": {
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/1895124567"
}
},
{
"@id": "https://disprot.org/DP00005#disorder-content",
"@type": "schema:SequenceAnnotation",
"additionalProperty": {
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/924391138"
},
"schema:sequenceLocation": {
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/235465215"
}
},
{
"@id": "https://disprot.org/DP00005r001",
"@type": "schema:SequenceAnnotation",
"additionalProperty": {
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/1257796954"
},
"schema:sequenceLocation": {
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/661824365"
},
"subjectOf": {
"@id": "https://identifiers.org/pubmed:9659923"
}
},
{
"@id": "https://disprot.org/DP00005r004",
"@type": "schema:SequenceAnnotation",
"additionalProperty": {
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/37194791"
},
"schema:sequenceLocation": {
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/726966167"
},
"subjectOf": {
"@id": "https://identifiers.org/pubmed:21936008"
}
},
{
"@id": "https://disprot.org/DP00005r005",
"@type": "schema:SequenceAnnotation",
"additionalProperty": {
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/1009444519"
},
"schema:sequenceLocation": {
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/679459059"
},
"subjectOf": {
"@id": "https://identifiers.org/pubmed:9063900"
}
},
{
"@id": "https://disprot.org/DP00005r006",
"@type": "schema:SequenceAnnotation",
"additionalProperty": {
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/1682055931"
},
"schema:sequenceLocation": {
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/339817883"
},
"subjectOf": {
"@id": "https://identifiers.org/pubmed:9063900"
}
},
{
"@id": "https://disprot.org/DP00005r007",
"@type": "schema:SequenceAnnotation",
"additionalProperty": {
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/346339967"
},
"schema:sequenceLocation": {
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/2005379000"
},
"subjectOf": {
"@id": "https://identifiers.org/pubmed:9063900"
}
},
{
"@id": "https://disprot.org/DP00005r008",
"@type": "schema:SequenceAnnotation",
"additionalProperty": {
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/1535211358"
},
"schema:sequenceLocation": {
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/313846963"
},
"subjectOf": {
"@id": "https://identifiers.org/pubmed:9063900"
}
},
{
"@id": "https://disprot.org/DP00005r009",
"@type": "schema:SequenceAnnotation",
"additionalProperty": {
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/594029466"
},
"schema:sequenceLocation": {
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/1271382721"
},
"subjectOf": {
"@id": "https://identifiers.org/pubmed:9063900"
}
},
{
"@id": "https://disprot.org/DP00005r010",
"@type": "schema:SequenceAnnotation",
"additionalProperty": {
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/622723804"
},
"schema:sequenceLocation": {
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/1786460745"
},
"subjectOf": {
"@id": "https://identifiers.org/pubmed:30795892"
}
},
{
"@id": "https://disprot.org/DP00005r011",
"@type": "schema:SequenceAnnotation",
"additionalProperty": {
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/422739231"
},
"schema:sequenceLocation": {
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/1906093950"
},
"subjectOf": {
"@id": "https://identifiers.org/pubmed:30795892"
}
},
{
"@id": "https://disprot.org/DP00005r012",
"@type": "schema:SequenceAnnotation",
"additionalProperty": {
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/1603435240"
},
"schema:sequenceLocation": {
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/868802206"
},
"subjectOf": {
"@id": "https://identifiers.org/pubmed:9659923"
}
},
{
"@id": "https://disprot.org/DP00005r013",
"@type": "schema:SequenceAnnotation",
"additionalProperty": {
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/1199537498"
},
"schema:sequenceLocation": {
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/1077537019"
},
"subjectOf": {
"@id": "https://identifiers.org/pubmed:9659923"
}
},
{
"@id": "https://disprot.org/DP00005r014",
"@type": "schema:SequenceAnnotation",
"additionalProperty": {
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/652441487"
},
"schema:sequenceLocation": {
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/2145892216"
},
"subjectOf": {
"@id": "https://identifiers.org/pubmed:9659923"
}
},
{
"@id": "https://disprot.org/DP00005r015",
"@type": "schema:SequenceAnnotation",
"additionalProperty": {
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/851963025"
},
"schema:sequenceLocation": {
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/524863385"
},
"subjectOf": {
"@id": "https://identifiers.org/pubmed:9659923"
}
},
{
"@id": "https://disprot.org/DP00005r016",
"@type": "schema:SequenceAnnotation",
"additionalProperty": {
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/2011680892"
},
"schema:sequenceLocation": {
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/550065185"
},
"subjectOf": {
"@id": "https://identifiers.org/pubmed:9659923"
}
},
{
"@id": "https://disprot.org/DP00005r017",
"@type": "schema:SequenceAnnotation",
"additionalProperty": {
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/1666891346"
},
"schema:sequenceLocation": {
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/945847033"
},
"subjectOf": {
"@id": "https://identifiers.org/pubmed:10759866"
}
},
{
"@id": "https://disprot.org/DP00005r018",
"@type": "schema:SequenceAnnotation",
"additionalProperty": {
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/1413740343"
},
"schema:sequenceLocation": {
"@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/2079549948"
},
"subjectOf": {
"@id": "https://identifiers.org/pubmed:10759866"
}
},
{
"@id": "https://disprot.org/assets/data/IDPO_v0.2.owl",
"@type": "DefinedTermSet",
"name": "IDP ontology"
},
{
"@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00050",
"@type": "DefinedTerm",
"inDefinedTermSet": {
"@id": "https://disprot.org/assets/data/IDPO_v0.2.owl"
},
"name": "disorder to order",
"termCode": "IDPO:00050"
},
{
"@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00063",
"@type": "DefinedTerm",
"inDefinedTermSet": {
"@id": "https://disprot.org/assets/data/IDPO_v0.2.owl"
},
"name": "protein binding",
"termCode": "IDPO:00063"
},
{
"@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00066",
"@type": "DefinedTerm",
"inDefinedTermSet": {
"@id": "https://disprot.org/assets/data/IDPO_v0.2.owl"
},
"name": "RNA binding",
"termCode": "IDPO:00066"
},
{
"@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00076",
"@type": "DefinedTerm",
"inDefinedTermSet": {
"@id": "https://disprot.org/assets/data/IDPO_v0.2.owl"
},
"name": "disorder",
"termCode": "IDPO:00076"
},
{
"@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00510",
"@type": "DefinedTerm",
"inDefinedTermSet": {
"@id": "https://disprot.org/assets/data/IDPO_v0.2.owl"
},
"name": "molecular function regulator",
"termCode": "IDPO:00510"
},
{
"@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00511",
"@type": "DefinedTerm",
"inDefinedTermSet": {
"@id": "https://disprot.org/assets/data/IDPO_v0.2.owl"
},
"name": "molecular function activator activity",
"termCode": "IDPO:00511"
},
{
"@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00517",
"@type": "DefinedTerm",
"inDefinedTermSet": {
"@id": "https://disprot.org/assets/data/IDPO_v0.2.owl"
},
"name": "molecular adaptor activity",
"termCode": "IDPO:00517"
},
{
"@id": "https://disprot.org/browse",
"dct:title": "DisProt"
},
{
"@id": "https://doi.org/10.1093/nar/gkz975",
"@type": "ScholarlyArticle",
"name": "DisProt: intrinsic protein disorder annotation in 2020",
"sameAs": [
{
"@id": "https://academic.oup.com/nar/advance-article/doi/10.1093/nar/gkz975/5622715"
},
{
"@id": "https://pubmed.ncbi.nlm.nih.gov/31713636"
}
],
"url": {
"@id": "https://doi.org/10.1093/nar/gkz975"
}
},
{
"@id": "https://identifiers.org/pubmed:10759866",
"@type": "ScholarlyArticle"
},
{
"@id": "https://identifiers.org/pubmed:21936008",
"@type": "ScholarlyArticle"
},
{
"@id": "https://identifiers.org/pubmed:30795892",
"@type": "ScholarlyArticle"
},
{
"@id": "https://identifiers.org/pubmed:8632448",
"@type": "ScholarlyArticle"
},
{
"@id": "https://identifiers.org/pubmed:9063900",
"@type": "ScholarlyArticle"
},
{
"@id": "https://identifiers.org/pubmed:9452503",
"@type": "ScholarlyArticle"
},
{
"@id": "https://identifiers.org/pubmed:9659923",
"@type": "ScholarlyArticle"
}
]
}
Sign up for free to join this conversation on GitHub. Already have an account? Sign in to comment