Created
November 2, 2018 15:19
-
-
Save sorsaffari/e7052dcf6b6bbaa24dab78450232962f to your computer and use it in GitHub Desktop.
Protein Structure Prediction: Get all structures of a particular sequence
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| match | |
| $target-sequence isa sequence "MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQIHFVLNTVSLMSVLIPKLPQLHGVRIFGINKY"; | |
| $structure isa structure; | |
| (mapping-sequence: $target-sequence, mapped-structure: $structure) isa sequence-structure-mapping; | |
| get $structure; |
Sign up for free
to join this conversation on GitHub.
Already have an account?
Sign in to comment