Skip to content

Instantly share code, notes, and snippets.

@sorsaffari
Created November 2, 2018 15:19
Show Gist options
  • Select an option

  • Save sorsaffari/e7052dcf6b6bbaa24dab78450232962f to your computer and use it in GitHub Desktop.

Select an option

Save sorsaffari/e7052dcf6b6bbaa24dab78450232962f to your computer and use it in GitHub Desktop.
Protein Structure Prediction: Get all structures of a particular sequence
match
$target-sequence isa sequence "MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQIHFVLNTVSLMSVLIPKLPQLHGVRIFGINKY";
$structure isa structure;
(mapping-sequence: $target-sequence, mapped-structure: $structure) isa sequence-structure-mapping;
get $structure;
Sign up for free to join this conversation on GitHub. Already have an account? Sign in to comment