Created
October 2, 2016 19:29
-
-
Save ShingoFukuyama/5e15b8873b36780fb424260dee9975fd to your computer and use it in GitHub Desktop.
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| // ==UserScript== | |
| // @name 0AutoPagerize SITEINFO | |
| // @namespace http://ss-o.net/ | |
| // @description oAutoPagerize SITEINFO | |
| // @include http* | |
| // @checkurl http://ss-o.net/userjs/0AutoPagerize.SITEINFO.user.js | |
| // ==/UserScript== | |
| (function(){ | |
| if (this.chrome) { | |
| window.addEventListener('ChromeAutoPagerizeInitialize',function(evt){ | |
| if (evt.setSiteinfo) evt.setSiteinfo(window.AutoPagerizeWedataSiteinfo); | |
| }, false); | |
| } | |
| window.AutoPagerizeWedataSiteinfo = [ | |
| { | |
| "url":"^https?(://[^.]+\\.wik(?:i(?:[mp]edia|books|news|quote|s(?:ource|pecies)|versity)|tionary)\\.org|s://secure.wikimedia.org/wik(?:i(?:[mp]edia|books|news|quote|s(?:ource|pecies)|versity)|tionary)/[^/]+)/w(?:iki/|/index\\.php\\?title=)(?:Special|%E7%89%B9%E5%88%A5)(?::|%3A)(?:(?:Ancient|Deadend|Lonely|New|MostLinked|Short|Uncategorized)Pages|(?:MostLink|Un(?:categoriz|us)|Want)ed(?:Categori|Templat)es|AbuseLog|BlockList|(?:Broken|Double)Redirects|C(?:ategorie|ontribution|rossNamespaceLink)s|Disambiguations|FewestRevisions|Global(?:BlockList|Users)|L(?:i(?:nkSearch|st(?:Redirect|User)s)|og)|Most(?:Categorie|Revision)s|Protected(?:Page|Title)s|W(?:hatLinksHere|ithoutInterwiki|anted(?:File|Page)s)|%E(?:3%8(?:2%AB%E3%83%86%E3%82%B4%E3%83%AA%E3%81%AE%E5%A4%9A%E3%81%84%E3%83%9A%E3%83%BC%E3%82%B8|3%AD%E3%82%B0)|6%(?:8A%95%E7%A8%BF%E8%A8%98%E9%8C%B2|96%B0%E(?:3%81%97%E3%81%84%E3%83%9A%E3%83%BC%E3%82%B8|7%9D%80%E3%83%95%E3%82%A1%E3%82%A4%E3%83%AB))|7%B7%A8%E9%9B%86%E5%B1%A5%E6%AD%B4%E3%81%AE%E5%A4%9A%E3%81%84%E3%83%9A%E3%83%BC%E3%82%B8|8%A2%AB%E3%83%AA%E3%83%B3%E3%82%AF%E3%81%AE%E5%A4%9A%E3%81%84%E3%83%(?:86%E3%83%B3%E3%83%97%E3%83%AC%E3%83%BC%E3%83%88|9(?:5%E3%82%A1%E3%82%A4%E3%83%AB|A%E3%83%BC%E3%82%B8))))", | |
| "pageElement":"id('mw-content-text')/ul/li", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":29357 | |
| }, | |
| { | |
| "url":"^http://www\\.(?:e(?:nigmaporn|tatube)|fuckdivision|geniusporn|h(?:ardconia|umphub)|insidertube|madtwist|porn(?:dogma|tower)|rhotube|s(?:crewvids|exulus|uckchannel)|t(?:ooxee|rontube|(?:ube(?:focus|fusion|jungle|nix|ton)))|x(?:navigate|twister))\\.com/", | |
| "pageElement":"//div[contains(concat(\" \", @class, \" \"), \" thumbs_main \")]", | |
| "nextLink":"//div[contains(concat(\" \", @class, \" \"), \" pages \")]/div/ul/li/a[@title=\"page-next\"]", | |
| "wedata.net.id":57175 | |
| }, | |
| { | |
| "url":"^https?://.*(unmatchedstyle|mozillazine|discovermagazine|blueblack|avenew|bugyo\\.tk/lyrical/|news\\.opensuse|arduino|protocolostomy|fluidinfo|php6\\.jp/python|new-jav|blogs?\\.(getfirebug|fluidinfo)|gimp\\.ironsand|cuffs-sphere|newalbumreleases)", | |
| "pageElement":"(//article|//div[starts-with(@id,'post-')])[not(id('load-more-posts') or ancestor::article or ancestor::*[starts-with(@id,'post-') or @id='fpost'])]|id('content')/div[contains(@class,'post')]", | |
| "nextLink":"//div[contains(concat(' ',@class,' '),' alignleft ')]/a", | |
| "wedata.net.id":683 | |
| }, | |
| { | |
| "url":"^http://news\\.mynavi\\.jp/series/(misutenaide|osakasora|kitami|itazuraoumu|joe|bakeneko|siba|kinya|4couples|hokori|029umai|pomeo|appeal-of-the-cat|coupleline|banker|flamethrower|tamerukun)/|^http://news\\.mynavi\\.jp/column/arasa", | |
| "pageElement":"//div[contains(@class,\"center\")][not(.//img[contains(@src,\"images/1000.jpg\") or contains(@src,\"images/tameru.jpg\") or //link[@rel=\"canonical\"][contains(@href,\"banker\")]])]|//p[@class=\"lyt-hdg-03-03\"][not(//link[@rel=\"canonical\"][contains(@href,\"misutenaide\") or contains(@href,\"osakasora\") or contains(@href,\"kitami\")])]|//div[contains(@class,\"center\")][.//img[contains(@src,\"images/002.jpg\")]][//link[@rel=\"canonical\"][contains(@href,\"banker\")]]|//div[contains(@class,\"center\")]/following-sibling::h3[./following-sibling::div[contains(@class,\"center\")]][//link[@rel=\"canonical\"][contains(@href,\"appeal-of-the-cat\")]]", | |
| "nextLink":"//link[@rel='next']", | |
| "wedata.net.id":76948 | |
| }, | |
| { | |
| "url":"^http://erogamescape\\.d(?:do\\.jp|yndns\\.org)/~ap2/ero/toukei_kaiseki/(?:(?:(?:creater_fans|game|o(?:_povlist)?|pov(?:list)?)_)?comments?(?:_(?:(?:before|new)game|respons|t(?:ime|ouhyou|rial)))?|(?:pov|usersql_)list)\\.php", | |
| "pageElement":"id(\"comment comments fans_comments okazu_comment pov_contents pov_okazu_comment\") | //div[@class=\"coment\"]", | |
| "nextLink":"//a[contains(text(),\"次の\")]", | |
| "wedata.net.id":29425 | |
| }, | |
| { | |
| "url":"^http://sp\\.pf\\.mbga\\.jp/120(0|1)(9101|8054|9496|9402|0267)/\\?(?:[^&?]*&)*?url=http%3A%2F%2F203\\.104\\.(245\\.115%2Fgang|255\\.211%2Fsengoku_mbga|249\\.202%2Fspirits|255\\.115%2Fseiya|253\\.179%2Fhero)%2F", | |
| "insertBefore":"id('top')/div[@id='pics']/div[@class='footerArea displayBox'][2]", | |
| "pageElement":"id('top')/div[@id='pics']/div[@class='footerArea displayBox'][2]/preceding-sibling::node()", | |
| "nextLink":"id('top')//a[@accesskey='#' or (@class='a_link' and (.='次へ→' or .='次の話へ→')) or img[contains(@src,'next')]]", | |
| "wedata.net.id":59875 | |
| }, | |
| { | |
| "url":"^http://erogamescape\\.d(?:do\\.jp|yndns\\.org)/~ap2/ero/toukei_kaiseki/user_(?:(?:favorites|play_game|pov)_)?(?:comment(?:_(?:before|consumer|group|hitouhyou|respons(?:ed)?|tokuten|trial))?|favorites)\\.php", | |
| "pageElement":"id(\"comments_main touhyou_comments\") | //div[@class=\"coment\"][2]", | |
| "nextLink":"//a[contains(text(),\"次の\")]", | |
| "wedata.net.id":29426 | |
| }, | |
| { | |
| "url":"^http://www\\.slrclub\\.com/bbs/zboard\\.php\\?id=(?:fre|ad_|pds|use|mar|pr|fin|can|con|fuj|has|kod|lei|nik|oly|pan|pen|sam|sig|min|mov|dig|tam|tok|fil|rf_|pho|com|off|slr|bes|cf_|new|ser|fie|event\\&)", | |
| "pageElement":"id('bbs_list')/tbody/tr", | |
| "nextLink":"//a[@class='next1 bh bt_n1']", | |
| "wedata.net.id":53304 | |
| }, | |
| { | |
| "url":"^http://(www\\.geocities.jp/kimagure_aa|kure352\\.fc2web\\.com|kimagure\\.nobody\\.jp|kimagure2\\.gozaru\\.jp|(smile|peace)\\.kakiko\\.com/kimagure|kurenai6\\.kt\\.fc2\\.com)/.+/.*\\d+\\.html?$", | |
| "pageElement":"//dl", | |
| "nextLink":"//a[contains(text(),\"進む\")]", | |
| "wedata.net.id":63823 | |
| }, | |
| { | |
| "url":"^https?://www\\.toranoana\\.jp/(?:mailorder|bl)/(?:article/\\d{2}/\\d{4}/\\d{2}/\\d{2}/\\d{12}_popup\\d|(?:m(?:pc|dv|cd)|c[io]t|bok|hob)/pagekit/\\d{4}/\\d{2}/\\d{2}/\\d{12}/popup_\\d+)\\.html", | |
| "pageElement":"//img", | |
| "nextLink":"//table//td[@align=\"right\"]/a", | |
| "wedata.net.id":33185 | |
| }, | |
| { | |
| "url":"^http://news\\.mynavi\\.jp/series/(akagoshigusa|katadukanai|presentation|u-san|philosophy|akago|dagr|fufugenka|kamisama|kourei)/|^http://news\\.mynavi\\.jp/column/worldheritage", | |
| "pageElement":"//div[contains(@class,\"center\")][.//img[contains(@src,\"images/001.jpg\") or contains(@src,\"images/002.jpg\") or contains(@src,\"images/003.jpg\") or contains(@src,\"images/004.jpg\")]]|//p[@class=\"lyt-hdg-03-03\"]|//div[contains(@class,\"center\")][.//img[contains(@src,\"images/001.jpg\") or contains(@src,\"images/002.jpg\") or contains(@src,\"images/003.jpg\") or contains(@src,\"images/004.jpg\")]]/preceding-sibling::*[not(.//img[contains(@src,\"images/kenka.jpg\") or contains(@src,\"images/kamisama.jpg\")])]", | |
| "nextLink":"//link[@rel=\"next\"]", | |
| "wedata.net.id":80852 | |
| }, | |
| { | |
| "url":"^https://addons\\.mozilla\\.org/[^/]+/[^/]+/(browse/type:[124]/cat:|(((collect|extens)ion|user|addon/[^/]+/(review|version))s|search(-tools)?|(complete-)?t(ag|hemes))/)", | |
| "pageElement":"//div[@class='item' or contains(concat(' ',@class,' '), ' items ') or contains(concat(' ', @class,' '), ' review ')][not(div/@class='review c item' or p/@class='no-reviews no-results')]|//ul[contains(concat(' ',@class,' '), ' thumbs ') or @class='personas-grid']/li", | |
| "nextLink":"//a[@rel='next']|//p[@class='rel']/a[@class='button next']", | |
| "wedata.net.id":897 | |
| }, | |
| { | |
| "url":"^http://(?:articles|herocomplex|www)\\.((la|carrollcounty)times|chicagotribune|(orlando|sun-)sentinel|(capital|va)gazette|baltimoresun|courant|mcall|dailypress)\\.com", | |
| "pageElement":"id('mod-hp-article-list')/div[@class='article']|id('area-center-w-left')//div[contains(@class,'mod-articletext') and p]|id('article')/div[@class='results']/div[@class='result' or @class='result last']|id('article')/div[@class='search-result']|//section[@class='trb_outfit_group trb_outfit_section']|//div[@class='trb_searchresults']", | |
| "nextLink":"//span[@class='pagination_sep'][last()]/following-sibling::span/a|//div[@class='floatleft']/a|//div[@class=\"trb_search_pagination\"]/span/following-sibling::a[1]|//a[@class='trb_search_pagination_next']", | |
| "wedata.net.id":28273 | |
| }, | |
| { | |
| "url":"^https?://(?:www\\.k\\.kyoto-u\\.ac\\.jp|student\\.iimc\\.kyoto-u\\.ac\\.jp/iwproxy/KULASIS)/student/(?:la|[gu]/[a-z]+)/(?:syllabus/|timeslot/lecture_)search", | |
| "pageElement":"//table[@class=\"standard_list\"]", | |
| "nextLink":"//a[@class=\"pager_link\"][contains(text(), \"\u6b21\u306e\")]", | |
| "wedata.net.id":29361 | |
| }, | |
| { | |
| "url":"^http://(?:booksl?|comic|h(?:ome|ana)|maniax|www)\\.dlsite\\.com/(?:(?:booksl?|comic|h(?:ome|ana)|maniax)/)?popup/=/file/smp\\d/product_id/[BR]J\\d+\\.html", | |
| "pageElement":"//div[@class=\"infomation\" and .//img]|id(\"work_sample_img\")", | |
| "nextLink":"id(\"next_img\")/a|id(\"page\")/following-sibling::td/a", | |
| "wedata.net.id":33172 | |
| }, | |
| { | |
| "url":"^http://(?:[^/]+\\.)?novelist\\.jp/((?:category|(?:ranking_(?:author|day|week))|tag(?:_list)?|(?:user_)?search|work_list(?:_all)?)\\.php|.+_p.+\\.html)", | |
| "pageElement":"//div[@class='usersearch_box' or @class='work_list_item']|//div[@class='line_h24px']/node()|//div[@class='work_read_header']/following-sibling::node()[ following::div/@class='work_read_footer']", | |
| "nextLink":"//a[@title='next page' or @class='next_page']", | |
| "wedata.net.id":31640 | |
| }, | |
| { | |
| "url":"^http://(?:(?:activeden|audiojungle|themeforest|videohive|graphicriver|3docean|codecanyon|photodune)\\.net|marketplace\\.tutsplus\\.com)/", | |
| "pageElement":"//ul[@class='product-grid' or starts-with(@class,'posts')]/li", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":55181 | |
| }, | |
| { | |
| "url":"^http://ippo-sanbu\\.tv/videos/latest|^http://ippo-sanbu\\.tv/actresses|^http://ippo-sanbu\\.tv/ranking/(popular|actress|play|recorded)", | |
| "pageElement":"//div[@id=\"contents\"]", | |
| "nextLink":"//a[(text()=\"次へ\")]", | |
| "wedata.net.id":77857 | |
| }, | |
| { | |
| "url":"^http://(?:a(?:pplemania|utokult)|(?:fotoblog|hdtvman)ia|lajfmajster|g(?:adzetomania|rrr)|komorkomania|niezlekino|simblog|vbeta).pl/", | |
| "pageElement":"//article", | |
| "nextLink":"//a[@class='load-content__btn']", | |
| "wedata.net.id":32559 | |
| }, | |
| { | |
| "url":"^http://natalie\\.mu/comic/news/(?:4(?:65(?:2(?:0|2|7)|3(?:1|2))|457(?:0|1|2|3|4)|18(?:67|8(?:2|8)|9(?:0|3))|08(?:8(?:3|7|8|9)|90)))", | |
| "pageElement":"//div[@class=\"NA_articleFigure\" or @class=\"NA_articleBody\"]", | |
| "nextLink":"//div[@class=\"NA_articleBody\"]//a[contains(.,\"つづく\")]", | |
| "wedata.net.id":54389 | |
| }, | |
| { | |
| "url":"^https?://.*(showthread\\.php\\?|(f|hist)or(um|o|ex)|threads?|/f/\\d+/|worldwide-invest|fiuxy|dp/node|eq2flames|hisseanaliz\\.net)", | |
| "pageElement":"//div[@id='posts' or div//td/@class='postContent']/*[.//*[starts-with(@id,'post')]]|//table[@class='bordercolor']//tr[.//tr/td[starts-with(@class,'windowbg')]]|(id('posts messageList')|//ul[starts-with(@class,'conversation-list')])/li[starts-with(@id,'post') or contains(@class,'js-post')]|id('comments')/div[not(@class='item-list')]|id('quickModForm')/div[contains(@class,'windowbg') or @class='bordercolor']", | |
| "nextLink":"(//link[//span/@class='scrollable']|//a)[@rel='next' or .='>' or .='Next ›' or .='Next >']|(//td[@class='middletext']|//div[starts-with(@class,'pagelinks') or contains(@class,'pagesclass')])/text()[contains(.,']')]/following-sibling::a[@class='navPages']|//span[contains(@class,'current')]/following-sibling::a[not(@class='go_page')]|//li[starts-with(@class,'pager-next')]/a", | |
| "wedata.net.id":65332 | |
| }, | |
| { | |
| "url":"^http://bbs[1234]\\.agora\\.media\\.daum\\.net/gaia/do/(?:agora/issue|debate|kin|story)/(?:list|hot|agreeBasedBestArticleContent)", | |
| "pageElement":"id(\"Issue\")/div[contains(concat(\" \", @class, \" \"), \" list \")] | //table[contains(concat(\" \", @class, \" \"), \" gLlist \")]//tr[position()>1]", | |
| "nextLink":"id(\"num\")/b/following-sibling::a[1] | id(\"right\")/a", | |
| "wedata.net.id":53857 | |
| }, | |
| { | |
| "url":"^http://b\\.hatena\\.ne\\.jp/(?:jkondo|entrylist|hotentry|t|keyword|[-\\w]+/(?:bookmark|group|favorite|starfriends|asin))mobile", | |
| "pageElement":"//a[@accesskey='6' or @accesskey='4']/ancestor::div[position()<3]/preceding-sibling::div[contains(@style, 'background') or contains(div/@style, 'background')][.//a]", | |
| "nextLink":"//a[@accesskey='6']", | |
| "wedata.net.id":55504 | |
| }, | |
| { | |
| "url":"^http://(www\\.)?(damnyouautocorrect|(parentsshouldnt|wrongnumber|damnfunny)texts?|awkwardnames|parentfails|epicwtfs)\\.com/", | |
| "pageElement":"//div[starts-with(@id,'post-')]|id('content')/*[self::h1 or @class='post-content']|//div[@class='title' or @class='copy' or @class='footer'][not(id('content')/*[self::h1 or @class='post-content'])]", | |
| "nextLink":"(id('post_link_next')|//div[@class='prev-next-btn next'])/a|//a[@class='btnNext']", | |
| "wedata.net.id":74831 | |
| }, | |
| { | |
| "url":"^https?://www\\.amazon\\.(?:c(?:a|o(?:m|\\.(?:jp|uk)))|de|fr)/(?:[^/]+/)?(?:(?:customer|product)-reviews|review/product)/", | |
| "pageElement":"//div[@class='a-section review']", | |
| "nextLink":"//li[@class='a-last']/a", | |
| "wedata.net.id":27473 | |
| }, | |
| { | |
| "url":"^https?://lib-www\\.smt\\.city\\.sendai\\.jp/licsxp-opac/WOpacTif(?:.*?SchCmpdExec|JunlChoSelect|TilListDisp)Action\\.do", | |
| "pageElement":"//table[@class='list']/tbody/tr", | |
| "nextLink":"//span[@class='cur']/following-sibling::a[1]", | |
| "wedata.net.id":33054 | |
| }, | |
| { | |
| "url":"^http://www\\.slrclub\\.com/bbs/zboard\\.php\\?[^#]*?\\bid=(?:equip_board|safe_market|discuss|tempbb|event_sony_gallery)", | |
| "pageElement":"id('slrct')/*[//div/@class='cmt_ctr']|id('slrct')/form/table/tbody/tr/td/* | id('slrct')/div[@id='slrct']/form/table/tbody/tr/td/* | id('slrct')/ul[@id='gal_list']/*", | |
| "nextLink":"//a[contains(concat(' ', @class, ' '), ' next1 ')]", | |
| "wedata.net.id":54198 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.(?:mobile|play|shopping)|5i)01\\.com/(?:forumtopic|catlist|mytopics|topiclist|topicdetail)\\.php(?:.*)", | |
| "pageElement":"id('maincontent')//tr[td]|//div[@class='single-post']", | |
| "nextLink":"//a[contains(.,'下一頁 ›')]", | |
| "wedata.net.id":29249 | |
| }, | |
| { | |
| "url":"^http?://smile\\.amazon\\.(?:c(?:a|n|o(?:m|\\.(?:jp|uk)))|de|fr)/(?:[^/]+/)?(?:[bes]|(?:gp|exec/obidos)/(search|aag))", | |
| "pageElement":"id(\"rightResults atfResults btfResults mainResults Results sparseWrapper\")[not(//link[@rel=\"canonical\"][contains(@href,\"page\")])]//*[starts-with(@id,\"result_\")]|//li[@class=\"shoveler-cell\"]|id(\"resultsCol\")[//link[@rel=\"canonical\"][contains(@href,\"page\")]]", | |
| "nextLink":"id('pagnNextLink')|//a[@class='next-button-link']", | |
| "wedata.net.id":77840 | |
| }, | |
| { | |
| "url":"^http://(?:auctions\\.search|(?:openuser|sellinglist|storeuser\\d+|list\\d+|category)\\.auctions)\\.yahoo\\.co\\.jp/", | |
| "pageElement":"id(\"list01\")/table/tbody/tr[(td[@class=\"a1\" or @class=\"s1\" or @class=\"pad01\"] or @bgcolor=\"#eeeeee\") and not(@class=\"ch01\")]", | |
| "nextLink":"id(\"ASsp1\")/p[@class=\"next\"]/a", | |
| "wedata.net.id":582 | |
| }, | |
| { | |
| "url":"^https?://www\\.amazon\\.(?:c(?:a|n|o(?:m|\\.(?:jp|uk)))|de|fr)/(?:[^/]+/)?(?:[bes]|(?:gp|exec/obidos)/(search|aag))", | |
| "pageElement":"id(\"rightResults atfResults btfResults mainResults Results sparseWrapper\")[not(//link[@rel=\"canonical\"][contains(@href,\"page\")])]//*[starts-with(@id,\"result_\")]|//li[@class=\"shoveler-cell\"]|id(\"resultsCol\")[//link[@rel=\"canonical\"][contains(@href,\"page\")]]", | |
| "nextLink":"id('pagnNextLink')|//a[@class='next-button-link']", | |
| "wedata.net.id":418 | |
| }, | |
| { | |
| "url":"^http://c(?:h|om).nicovideo.jp/(?:c(?:hannel|om(?:_new|munity))|live_archives|me(?:mber|nu/)|search|(?:ppv_)?video)", | |
| "pageElement":"id('main0727')//table/tbody/tr[td]|//section[contains(@class,'contents_list')]/header/following::ul[1]/li[@class='item']", | |
| "nextLink":"(//a|//link)[(.|..)/@class='next']", | |
| "wedata.net.id":1934 | |
| }, | |
| { | |
| "url":"^http://sp\\.pf\\.mbga\\.jp/12008305/\\?(?:[^&?]*&)*?url=http%3A%2F%2F125\\.6\\.16(?:9\\.35|1\\.44)%2Fidolmaster%2F", | |
| "pageElement":"id(\"top\")/div[@class=\"infoLink\" or (contains(concat(\" \",@class,\" \"),\" title_hanyo \") and contains(./following-sibling::div[1]/img/@src,\"theater\")) or img[contains(@src,\"theater\") or contains(@src,\"quest%2Fbg_area\")] or a[@name=\"isearch\"]]|id(\"top\")[descendant-or-self::div[contains(concat(\" \",@class,\" \"),\"fukidashi\") or img[contains(@src,\"quest%2Fbg_area\")]]]/div[@id=\"pics\"]/following-sibling::node()[following::div[@class=\"backLink\"]]|id(\"top\")/div[form[@name=\"sort_form\" or @name=\"select_fomr\"][count(select)=1]]/following-sibling::*[following-sibling::div[.//a[@accesskey=\"#\" or @accesskey=\"*\"]]]|(id(\"top\")|id(\"top\")/div)/div[(.//a[@accesskey=\"#\" or @accesskey=\"*\"]) or contains(.,\"お仕事に\") or contains(.,\"贈り物\") or contains(.,\"成績表\") or contains(.,\"掲示板\") or contains(.,\"増資\") or contains(.,\"モバ友の\") or contains(.,\"ステージ衣装一覧\") or contains(.,\"宿敵一覧\") or contains(.,\"対戦経過\") or contains(.,\"所属社員\") or contains(.,\"メンバーの位置\") or contains(.,\"目次\") or contains(.,\"フリートレードチケット\") or contains(.,\"登録と完了併せて10件まで\") or contains(.,\"完了したフリートレード\") or contains(.,\"アイテム一覧\") or contains(.,\"カムバック対象者一覧\") or contains(.,\"ユニットLIVE\") or @class=\"navi\" or form[not(@name=\"sort_form\" or @name=\"select_fomr\")]]/following-sibling::node()[not(self::div[form[@name=\"select_fomr\"][count(select)=7]]) and following-sibling::div[.//a[@accesskey=\"#\" or @accesskey=\"*\" or (@class=\"a_link\" and (.=\"次へ→\" or .=\"←前へ\"))]]]|id(\"top\")/div[a[@accesskey=\"#\" or @accesskey=\"*\"]]/following-sibling::*[following-sibling::div[form[@name=\"select_fomr\"][count(select)=7]]]|id(\"top\")[count(div[@id=\"pics\"])=1]/div/div[@id=\"pics\"]/preceding-sibling::node()|id(\"top\")/table[.//a[contains(@href,\"theater\")]]|(id(\"top\")//div[@id=\"pics\"])[2]/preceding-sibling::node()[1]|id(\"headerAcdPanel\")[div[contains(concat(\" \",@class,\" \"),\" area_name \")]]/*[following-sibling::*[.//@class=\"backLink\" or .//@class=\"paging\"]]|id(\"headerAcdPanel\")/div[form]/following-sibling::section|id(\"headerAcdPanel\")/div/*[following-sibling::*[.//@class=\"backLink\"]]|//section/div[contains(concat(\" \",normalize-space(@class),\" \"),\" idolStatus \")]", | |
| "nextLink":"id(\"top\")//a[@accesskey=\"#\" or (@class=\"a_link\" and (.=\"次へ→\" or .=\"次の話へ→\")) or img[contains(@src,\"next\")]]", | |
| "wedata.net.id":59518 | |
| }, | |
| { | |
| "url":"^http://natalie\\.mu/(?:(?:(?:com|mus)ic|eiga|o(?:yatsu|warai))/)?(?:news|gallery/show/news_id/\\d+/image_id)/\\d", | |
| "pageElement":"//div[@class=\"NA_galleryBody\" or @class = \"NA_articleBanner\" or @class=\"NA_articleFigure\" or @class=\"NA_articleBody\" or @class = \"NA_articleSup\"]", | |
| "nextLink":"//div[@class=\"NA_galleryNav\"]/ul/li[last()]/a|//div[@class=\"NA_articleFigure\"]/figure/a|//a[@class=\"NA_more\"]", | |
| "wedata.net.id":29498 | |
| }, | |
| { | |
| "url":"^http://board(?:[1234]\\.finance|\\.moneybook)\\.daum\\.net/gaia/do/(?:community|stocktotal|100|invest|finance)/", | |
| "pageElement":"id(\"bbsList\")/tbody/tr | id(\"commentList\")//ul[contains(concat(\" \", @class, \" \"), \" commentList \")] | id(\"form1\")/ul", | |
| "nextLink":"//table[contains(concat(\" \", @class, \" \"), \" pagingTable \")]//span[contains(concat(\" \", @class, \" \"), \" on \")]/following-sibling::span[1]/a | //div[contains(concat(\" \", @class, \" \"), \" pagingDiv \")]/strong/following-sibling::a[1]", | |
| "wedata.net.id":54436 | |
| }, | |
| { | |
| "url":"^http://(?:www|nine)\\.nicovideo\\.jp/(?:newarrival|mylist_search|migiue|openlist|recent|related_tag|search|tag)", | |
| "pageElement":"id('PAGEBODY')/div[starts-with(@class,'content_672')]/*[preceding::table/@class='pager' or preceding-sibling::div[h1][not(count(following::table[@class='pager'])=2)]][following::table/@class='pager'][not(self::script)]|//div[contains(concat(' ',normalize-space(@class),' '), ' main ') or @data-main-contents]/div[contains(@class,'contentBody')]/ul[@class='list']", | |
| "nextLink":"(/descendant::span|//div[@class='pager']/a)[contains(@class,'active') or contains(@class,'here')]/following-sibling::a[1]", | |
| "wedata.net.id":731 | |
| }, | |
| { | |
| "url":"^http://(?:danji)?board\\.realestate\\.daum\\.net/gaia/do/estate/(?:totalDebate|knowhow|totalDanji|issueDebate)/", | |
| "pageElement":"id('TotList')/tbody/tr | id('issueList')/li", | |
| "nextLink":"//em[@class='link_page']/following-sibling::a[1]", | |
| "wedata.net.id":54506 | |
| }, | |
| { | |
| "url":"^http://eldersign\\.jp/(book|[mc]card_select|bazaar|alchemy|scoreranking|eventpage|sort_mons|sort_comp)\\.php.*", | |
| "pageElement":"//nav[contains(concat(\" \",normalize-space(@class),\" \"), \" block \")]/ul[li/a[@href]]", | |
| "nextLink":"//li[contains(concat(\" \",normalize-space(@class),\" \"), \" next \")]/a[not(@class) or @class!=disable]", | |
| "wedata.net.id":65645 | |
| }, | |
| { | |
| "url":"^http://(?:dl|www)\\.toranoana\\.jp/(?:comiholi_a|webcomic/holic)/[^/]+(?:/webcomic)?/(?:\\d+|comics/summary)/", | |
| "pageElement":"//div[@align='center' or contains(@style, 'text-align: center;')]/a[img]", | |
| "nextLink":"//div[@align='center' or contains(@style, 'text-align: center;')]/a", | |
| "wedata.net.id":30938 | |
| }, | |
| { | |
| "url":"^https?://(?:meta\\.)?(?:s(?:erverfault|tackoverflow|uperuser|tackapps)|\\w+\\.stackexchange|askubuntu)\\.com/", | |
| "pageElement":"//div[contains(@class,'search-results') or contains(@id,'questions') or contains(@id,'answers')]/div[contains(@class,'question-') or contains(@id,'question-') or contains(@class,'answer-') or contains(@id,'answer-')]|//*[contains(@id,'-browser')]//tr", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":2759 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.geocities\\.jp/baku3zip\\d?|nagurigaki\\.web\\.fc2\\.com/baku)/.+?/(?:\\d+/)?[^/]*\\d+\\.html", | |
| "pageElement":"//div[img]", | |
| "nextLink":"//div/hr[1]/preceding-sibling::a[position()=1 and not(starts-with(.,'TOP'))]", | |
| "wedata.net.id":39789 | |
| }, | |
| { | |
| "url":"^http://community\\.travel\\.yahoo\\.co\\.jp/(search/search_result|(?:abroad|domestic).*/b(?:log|uzz))\\.html", | |
| "pageElement":"(id('ytrvTmWrSearchBody')|//div[@class='ytrvTmWrDomMainBody'])/*[preceding-sibling::div/@class='ytrvTmMdPageNaviHead'][following-sibling::hr[last()]]", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":27874 | |
| }, | |
| { | |
| "url":"^http://news\\.mynavi\\.jp/series/rokujouhitoma/|^http://news\\.mynavi\\.jp/column/(ccmanga|cheerful-curry)/", | |
| "pageElement":"//div[@class=\"articleContent\"]//blockquote[1]/preceding-sibling::*|//div[@class=\"articleContent\"][not(.//blockquote)]//hr/preceding-sibling::*|//div[@class=\"articleContent\"][not(.//blockquote or .//hr)]//div[@class=\"left\"]/preceding-sibling::*|//p[@class=\"lyt-hdg-03-03\"]", | |
| "nextLink":"//link[@rel='next']", | |
| "wedata.net.id":80866 | |
| }, | |
| { | |
| "url":"^http://(?:acg|forum|webbbs|mbox)\\.gamer\\.com\\.tw/(?:B|C|board|index)\\.php\\?\\w+=[^&]+(?:&\\w+=[^&]+)*", | |
| "pageElement":"//tr[@class='FM-blist1']//following-sibling::tr|//div[@class='FM-cbox1']", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":54715 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)hongfire\\.com/(?:forum)/(?:showthread)\\.php/440156-Japanese-Conversation-for-beginners", | |
| "pageElement":"id(\"content\")/li", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":77677 | |
| }, | |
| { | |
| "url":"^http://movies\\.yahoo\\.co\\.jp/(news|movie|calendar|review|schedule|theater|present|trailer|interview)/", | |
| "pageElement":"//ul[contains(@class,'js-lazy-load-images')]/li", | |
| "nextLink":"//a[i/@class='icon-chevron-right color-sub']", | |
| "wedata.net.id":76490 | |
| }, | |
| { | |
| "url":"^http://www\\.manga-gai\\.net/(?:manga(?:kasoudan)?|column)/[^/]+/(?:\\d+(?:\\.\\d+|kan)?|\\w+)/\\d+.htm", | |
| "pageElement":"//td[@valign='middle' and ((@onclick and img) or form)]/ancestor::tr[2]|id('originalmanga')/table/tbody/tr[td[a/img or h4]]|id('originalmanga')/*[@class='manga_main' or @id='manga_main' or @class='manga_last']|//tr/td[@valign='top']/*[not(self::img[1] or self::div[last()])][not(id('originalmanga'))][not(//a[contains(img/@src,'manga-gai.net/manga/')])]", | |
| "nextLink":"//a[img/@name='next' or contains(.,'NEXT')]|//div[@align='center']/a[contains(.,'次')]|id('originalmanga')/*[self::p/@class='manga_main' or self::div/@id='manga_main']//a[img]", | |
| "wedata.net.id":39562 | |
| }, | |
| { | |
| "url":"^http://sp\\.pf\\.mbga\\.jp/12007160/\\?(?:[^&?]*&)*?url=http%3A%2F%2F203\\.131\\.198\\.133%2Fbahamut%2F", | |
| "insertBefore":"id(\"top\")/div[@id=\"pics\"]/div[@class=\"footerArea displayBox\"]", | |
| "pageElement":"id(\"top\")/div[@id=\"pics\"]/div[@class=\"footerArea displayBox\"]/preceding-sibling::node()", | |
| "nextLink":"id(\"top\")//a[@accesskey=\"#\" or (@class=\"a_link\" and (.=\"次へ→\" or .=\"次の話へ→\")) or img[contains(@src,\"next\")]]", | |
| "wedata.net.id":59873 | |
| }, | |
| { | |
| "url":"^http://www\\.comic-ryu\\.jp/(?:books/cyoiyomi/\\d{4}/\\w+|comics/\\w+/t_\\d+_?)/(?:pg\\d+|index)\\.html", | |
| "pageElement":"//table[@class=\"table\" and .//span[@class=\"img\"]]", | |
| "nextLink":"//span[@class=\"bdnavi-numbers\"]/text()[number()>0]/following-sibling::a", | |
| "wedata.net.id":57494 | |
| }, | |
| { | |
| "url":"^http://(?:members\\.jcom\\.home\\.ne\\.jp/w3c/omake/diary\\.html|noz\\.hp\\.infoseek\\.co\\.jp/diary/)", | |
| "pageElement":"id(\"maintitle\")/following-sibling::*[./following-sibling::h2]", | |
| "nextLink":"//h2/following::dt[contains(text(), \"前\")]/following-sibling::dd[2]/a", | |
| "wedata.net.id":2023 | |
| }, | |
| { | |
| "url":"^https?://(?:c(?:areer|ode)|enterprise|m(?:arke|oney))zine\\.jp/(?:a(?:rticle|uthor)/|\\w+online/|iti/)", | |
| "pageElement":"//ul[@class='catList']/li|//div[@class='article']", | |
| "nextLink":"//a[@rel='next' or ../@class='nextBtn']", | |
| "wedata.net.id":510 | |
| }, | |
| { | |
| "url":"^https://developer\\.apple\\.com/library/ios/documentation/Swift/Conceptual/Swift_Programming_Language/", | |
| "pageElement":"//article[@class='chapter']/*[self::h2 or @class='section' or @class='hideInXcode' or @class='important clear']", | |
| "nextLink":"//p[@class='next-link']/a", | |
| "wedata.net.id":74875 | |
| }, | |
| { | |
| "url":"^https?://musicbrainz\\.org/artist/[0-9a-f-]{36}/(releases|recordings|works)(\\?.*\\bpage=\\d+\\b.*)?$", | |
| "pageElement":"id(\"content\")/form/table/tbody/tr", | |
| "nextLink":"//nav/ul[@class=\"pagination\"]/li[last()]/a", | |
| "wedata.net.id":77190 | |
| }, | |
| { | |
| "url":"^http://www\\.cosme\\.net/(brand|effect|item|product)/\\1_id/\\d+/(?:chieco|products|ranking|reviews)", | |
| "pageElement":"id(\"chiecoListSmall chiecoListLarge productListSmall productListLarge reviewListSmall reviewListLarge keyword-qa-list keyword-product-list keyword-ranking-list keyword-review-list product-qa-list product-review-list\")/*", | |
| "nextLink":"//li[@class='next']/a|id('keyword-ranking-header')//li[@class='on']/following-sibling::li[1]/a", | |
| "wedata.net.id":30676 | |
| }, | |
| { | |
| "url":"^https?://www\\.amazon\\.(?:co(?:m|\\.jp)|de)/(?:gp/)?(?:registry/)?(?:wishlist[/?]|registry\\.html)?", | |
| "pageElement":"//div[@id='init-container']/div[@class='wlNoUnderline']/div[@class='list-items']|//div[contains(concat(\" \",@class,\" \"),\" g-items-section \")]/*rn", | |
| "nextLink":"id(\"bottomPagGradient\")/preceding-sibling::div[@class=\"pagDiv\"]/span[last()]/a|//span[contains(concat(\" \",@class,\" \"),\" pagSelected \")]/following-sibling::a|//li[contains(concat(\" \",@class,\" \"),\" a-selected \")]/following-sibling::li/a", | |
| "wedata.net.id":420 | |
| }, | |
| { | |
| "url":"^http://tv\\.so-net\\.ne\\.jp/(?:m/schedulesByFilter\\.action\\?|s(?:chedulesBySearch\\.action\\?|/))", | |
| "pageElement":"//div[@class='contBlockNB']/div[starts-with(@class,'utileList')]", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":2207 | |
| }, | |
| { | |
| "url":"^http://(?:community\\.adobe\\.com/help/search\\.html|www\\.adobe\\.com/cfusion/search/index.cfm)\\?", | |
| "pageElement":"id('search-results')/dl", | |
| "nextLink":"id('search-pagination')//a[contains(.,'»')]", | |
| "wedata.net.id":29082 | |
| }, | |
| { | |
| "url":"^http://steamcommunity\\.com/(workshop/browse|greenlight|app|(id|profiles)/([^/]+)/myworkshopfiles)", | |
| "pageElement":"//div[@class='workshopBrowseRow' or @class='workshopItemCollection' or a/@class='forum_topic_overlay']", | |
| "nextLink":"//a[@class='pagebtn'][.='>']", | |
| "wedata.net.id":59533 | |
| }, | |
| { | |
| "url":"^http://(?:c(?:hahan|urry)|ramen)db\\.supleks\\.jp/(?:commentlist/|rank|s(?:corelist|earch)|photo/)", | |
| "pageElement":"id('searched')/li|//table[@class='rank']/tbody/tr", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":2029 | |
| }, | |
| { | |
| "url":"^http://japanese\\.china\\.org\\.cn/\\w+(?:/txt)?/\\d{4}-\\d{2}/\\d{2}/content_\\d+(?:_\\d+)?\\.htm", | |
| "pageElement":"id('container_txt fontzoom')/*[not(@id='autopage')]", | |
| "nextLink":"id('autopage')//span/following-sibling::a", | |
| "wedata.net.id":58415 | |
| }, | |
| { | |
| "url":"^http://www\\.(?:geocities\\.jp/cba4jp/mado)|(?:medianetjapan\\.com/town/entertainment/cba2/ccc/md)", | |
| "pageElement":"//center/img | //center/table", | |
| "nextLink":"//center/a[starts-with(text(), \"\u524d\")]/following-sibling::a[1][not(text()=1)] | //table[not(parent::div)]//a[text()=1]", | |
| "wedata.net.id":37883 | |
| }, | |
| { | |
| "url":"^https?://.*((f|hist)or(ums?|o|ex)(display\\.php\\?)?|worldwide-invest|fiuxy|eq2flames|f319\\.com$)", | |
| "pageElement":"(//tbody|//div)[starts-with(@id,'threadbit')]/*[*[contains(@id,'td_threadtitle')] or @class!='thead'][not(contains(td/div,'Sticky:') or .//img[contains(@src,'sticky') or contains(@class,'sticky')])]|//table[.//@class='middletext']/following-sibling::div/table[@class='bordercolor']//tr[td/@class='windowbg']|id('topic_container')/div[@class='windowbg']|//ol[(@id='threads' and @class='threads') or @class='discussionListItems']/li[@id]|//div[@class='threadbit'][not(.//div[contains(.,'Sticky:')])]|id('messageindex')//tr[td/img]|//table[@class='tborder clear' or @class='table']//tr[@class='inline_row' or @class='row forumThread']|//table[starts-with(@id,'forum-topic') or starts-with(@class,'topic-list') or starts-with(@id,'forumTopic')]/tbody/tr[not(.//span[@class='prefix js-prefix'][contains(.,'Sticky:')] or contains(@class,'header'))]", | |
| "nextLink":"(//link[//span/@class='scrollable']|//a)[@rel='next' or .='>' or .='Next ›' or .='Next >']|(//td[@class='middletext']|//div[starts-with(@class,'pagelinks') or contains(@class,'pagesclass')]|//span[@class='di-ib'])/text()[contains(.,']')]/following-sibling::a[1]|//span[contains(@class,'current')]/following-sibling::a[not(@class='go_page')]|//li[starts-with(@class,'pager-next')]/a", | |
| "wedata.net.id":74668 | |
| }, | |
| { | |
| "url":"^https?://[^./]+\\.google(?:\\.[^./]{2,3}){1,2}/(?:c(?:se|ustom)|search|webhp|m|(\\?gws_rd=ssl)?#)", | |
| "pageElement":"id('res')//li[div]|//div[@class='gsc-webResult gsc-result' or @class='psli']|id('rso')//div[@class='g' or @class='g _cy']", | |
| "nextLink":"id('pnnext')|id('navbar navcnt nav')//td[span]/following-sibling::td[1]/a|id('nn')/parent::arn", | |
| "wedata.net.id":472 | |
| }, | |
| { | |
| "url":"^http://ippo-sanbu\\.tv/tags/|^http://ippo-sanbu\\.tv/video_search|^http://ippo-sanbu\\.tv/makers/", | |
| "pageElement":"//div[@class=\"item_linetype\" or @class=\"row clearfix\"]", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":77858 | |
| }, | |
| { | |
| "url":"^http://micron02syun\\.web\\.fc2\\.com/COMIC/(?:tanpen/)?\\w+-comic(?:s|-1)?/[\\w\\-]+\\d+\\.html", | |
| "pageElement":"//p/img", | |
| "nextLink":"//p/descendant::img/following::a[not(starts-with(@href, \"http\"))]", | |
| "wedata.net.id":37918 | |
| }, | |
| { | |
| "url":"^http://(?:us\\.)?(?:deadspin|g(?:awker|izmodo)|io9|j(?:alopnik|ezebel)|kotaku|lifehacker)\\.com/", | |
| "pageElement":"//div[starts-with(article/@id,'post')]", | |
| "nextLink":"//div[@class='text-center']/a", | |
| "wedata.net.id":500 | |
| }, | |
| { | |
| "url":"^http://news\\.mynavi\\.jp/(series|column)/(harutoaki|chinese|gekai|soba|line|zubora|numa|birth)/", | |
| "pageElement":"//div[contains(@class,\"center\")]|//div[contains(@class,\"center\")]/preceding-sibling::*[self::p or self::h3]|//div[contains(@class,\"center\")]/following-sibling::*[self::p or self::h3]|//p[@class=\"lyt-hdg-03-03\"]", | |
| "nextLink":"//link[@rel=\"next\"]", | |
| "wedata.net.id":80854 | |
| }, | |
| { | |
| "url":"^https?://www\\.furaffinity\\.net/(?:browse|msg/submissions|(?:favorites|gallery|scraps)/[^/]+)/", | |
| "pageElement":"//center[contains(@class,'flow')]/*", | |
| "nextLink":"//form[button/@value='Next']|//a[@class='More']", | |
| "wedata.net.id":2136 | |
| }, | |
| { | |
| "url":"^https?://(?:witcher|fallout3|dragonage|dungeondefenders|skyrim|tes|www)\\.nexusmods\\.com/mods/", | |
| "pageElement":"//ul[@class='block-list']/li|//div[@class='video_block']", | |
| "nextLink":"//div[@class='right']/a|//a[@title='next page']", | |
| "wedata.net.id":29558 | |
| }, | |
| { | |
| "url":"^http://(?:cn\\.last\\.fm|www\\.last(?:\\.fm|fm\\.(?:com\\.[bt]r|[^./]{2})))/(user|music)/[^/]+/", | |
| "pageElement":"(id('comments-container')|//ul[@class='user-list'])/li|//section[@class='tracklist-section']|id('user-loved-tracks-section')/table/tbody/tr|//li[@class='large-grid-wrapper']", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":2097 | |
| }, | |
| { | |
| "url":"^http://www\\.fujisan\\.co\\.jp/(?:NewSearch|zasshi_search|pub/|category/|product/\\d+/b/list/)", | |
| "pageElement":"//div[contains(concat(' ',@class, ' '),'backnumber-detail-area')]/* | //table[@class='list-table']//tr | //a[contains(@href, \"/Pub/\")][./b][count(./preceding-sibling::b)=3]/ancestor::table[2]/following-sibling::table[1]/descendant::table[1]/tbody/tr", | |
| "nextLink":"//div[@class='backnumber-pagenavi' or @class='pagination']/a[contains(.,'次へ')] | //a[contains(.,'次のページ')] | //a[contains(@href,'/Pub/') and b][preceding-sibling::b[3]][1]", | |
| "wedata.net.id":64140 | |
| }, | |
| { | |
| "url":"^http://(?:cn\\.last\\.fm|www\\.last(?:\\.fm|fm\\.(?:com\\.[bt]r|[^./]{2})))/user/[^/]+/journal", | |
| "pageElement":"//ul[@class='journals hfeed']", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":2725 | |
| }, | |
| { | |
| "url":"^http://www\\.nicovideo\\.jp/(?:my|user/\\d+)/(?:watchlist|community|channel|video|friend|fav)", | |
| "pageElement":"//div[@class=\"articleBody\"]/div[@class=\"outer\"]", | |
| "nextLink":"//div[@class=\"pager\"]/a[contains(text(),\"次へ\")]", | |
| "wedata.net.id":41267 | |
| }, | |
| { | |
| "url":"^(http://web\\.archive\\.org/web/\\d+/)*(?:http://)?(?:mnlt|n(?:code|ovel18))\\.syosetu\\.com/", | |
| "pageElement":"id('novel_color')/*[@class='novel_subtitle' or @id='novel_p' or @id='novel_a' or @id='novel_honbun' or @class='novel_bn']", | |
| "nextLink":"//div[@class='novel_bn']/a[contains(.,'次の話')]", | |
| "wedata.net.id":26587 | |
| }, | |
| { | |
| "url":"^http://(?:www115\\.sakura\\.ne\\.jp/~rr/animetamae|animetamae.com)/\\d{2}L?/s?\\d{2,4}\\.htm", | |
| "pageElement":"(//p|//table)[.//img]", | |
| "nextLink":"(//td|//p)/a[img]", | |
| "wedata.net.id":67292 | |
| }, | |
| { | |
| "url":"^http://blogs\\.yahoo\\.co\\.jp/[^/]+/(?:MYBLOG/yblog|folder/[^.]+|archive/\\d{4}|GALLERY/.)", | |
| "pageElement":"id('mainContentsArea')//*[@class='articleList' or @id='atcllst' or @class='articleList cf' or starts-with(self::ul[../@id='newestImages2']/@class,'clearFix')]", | |
| "nextLink":"//p[@class='sequentialNavi']/b/following-sibling::a[1]|id('mainContentsArea')/div[contains(@class,'pagingNavi3') and not(//div[contains(@class,'pagingNavi2')]//b/following-sibling::a)]/p/a", | |
| "wedata.net.id":579 | |
| }, | |
| { | |
| "url":"^http://[^.]+\\.areablog\\.jp/(?:blog/[^/]+/.+\\.html|(?:more_post|page_(?:img|list))\\.asp)", | |
| "pageElement":"//div[contains(@class,'post_table') or contains(@class,'blog_list') or contains(@class,'photo_pickup_page')]|id('blog_list_block')/div", | |
| "nextLink":"//a[.//.='以前の記事へ>>' or preceding-sibling::font/@color='red' or .='次へ']", | |
| "wedata.net.id":30101 | |
| }, | |
| { | |
| "url":"^https?://((?:cafeblog|image|kin|news|video|web)\\.)?search\\.naver\\.com/search\\.naver\\?", | |
| "pageElement":"id('content')/div[contains(concat(' ', @class, ' '), ' section ')]/ul/li", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":25695 | |
| }, | |
| { | |
| "url":"^http://movie-tsutaya\\.tsite\\.jp/netdvd/(dv|c)d/(search(Dv|c)d|hotrankingTopWeekly)\\.do", | |
| "pageElement":"//div[@class='ppdis00034WrapB clearfix' or @class='ppdis00016WrapC clearfix' or @class='ppdis00016WrapD clearfix' or @class='ppdis00016WrapE clearfix' or @class='searchWrapE' or @class='ppdis00053WrapC clearfix' or @class='ppdis00053WrapD clearfix' or @class='ppdis00053WrapE clearfix']//tr", | |
| "nextLink":"//li[@class='liNext']/a|//td[@class='sortViewType02On']/following-sibling::td[1]/a|//div[@class='sortView clearfix']/ul/li[@class='cellLast']/a[starts-with(.,'次')]", | |
| "wedata.net.id":1887 | |
| }, | |
| { | |
| "url":"^http://yorudori\\.sakura\\.ne\\.jp/\\w+/\\w+/(?:$|(?:(?:\\d+p?[_-])?\\d+p?|index)\\.html)", | |
| "pageElement":"id(\"main\")", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":51007 | |
| }, | |
| { | |
| "url":"^http://(?:lostheaven\\.jp|priwiz\\.net)/\\w+/(?:[A-Za-z]+\\d+/)?[A-Za-z]+\\d+-\\d+\\.html", | |
| "pageElement":"//p[a/img]", | |
| "nextLink":"//p/a[img]", | |
| "wedata.net.id":45685 | |
| }, | |
| { | |
| "url":"^http://www\\.(?:torinikusoul\\.com|geocities\\.jp/torinikusoul)/no\\d+/(?:cag)?\\d+\\.htm", | |
| "pageElement":"//a[img]", | |
| "nextLink":"//a[img]", | |
| "wedata.net.id":39980 | |
| }, | |
| { | |
| "url":"^http://[^/]+\\.impress\\.co\\.jp/img/\\w+/docs/\\d+/\\d+/photogallery/[^/]+\\.jpg\\.html", | |
| "pageElement":"(/html/*[not(self::body)]|/html/body/*)[.//@class=\"resourcepage_photoGalleryImage\" or .//@class=\"resourcepage_caption\"]|/html/body/script", | |
| "nextLink":"//div[@class=\"next_link\"]/a", | |
| "wedata.net.id":31360 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?tochigi-tv\\.jp/(?:performer|we)blog/(?:index\\.php)?\\?.*\\bcontents=", | |
| "pageElement":"id(\"contents\")//div[contains(concat(\" \", @class, \" \"), \" dayblogArea \") or contains(concat(\" \", @class, \" \"), \" TopicsInfo \")]", | |
| "nextLink":"id(\"contents\")/ul[contains(concat(\" \", @class, \" \"), \" txtLink \")]/li/a[@title=\"next page\"]", | |
| "wedata.net.id":48756 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?((tyrannyofpants\\.lens-capp|courting-disaster)\\.com|mercworks\\.net)", | |
| "pageElement":"id('comic')/*", | |
| "nextLink":"//a[contains(@class,'comic-nav-previous')]", | |
| "wedata.net.id":77642 | |
| }, | |
| { | |
| "url":"^https?://github\\.com/(?:$|dashboard|(?:timeline|[^/]+/[^/]+/(?:comments|network/feed)))", | |
| "pageElement":"//div[@class=\"news\"]/div[contains(@class, \"alert\")]", | |
| "nextLink":"//a[@hotkey=\"l\"]|//div[contains(concat(\" \",@class,\" \"),\" pagination \")]/a", | |
| "wedata.net.id":1219 | |
| }, | |
| { | |
| "url":"^http://(www\\.)?(?:(?:linux|mac|windows)devcenter|on(?:java|lamp)|perl|xml)\\.com/pub/a/", | |
| "pageElement":"id(\"article\")/*[(self::table and .//p[@class=\"secondary\"]/b) or (self::div and @class=\"noindex\")][1]/preceding-sibling::*[./preceding-sibling::*[self::h2 or (self::p and @class=\"secondary\")]]|id(\"article\")[not(./*[(self::table and .//p[@class=\"secondary\"]/b) or (self::div and @class=\"noindex\")])]/p[@class=\"secondary\"][1]/following-sibling::*|id(\"article\")/div[@class=\"noindex\" and ./div[@class=\"feedback\"]]|//div[@id='article']/br[2]/following-sibling::*[following-sibling::ol//table[@id='page-break']]|//div[@id='article']/ol/*[following-sibling::table/@id='page-break']", | |
| "nextLink":"id(\"article\")/table//p[@class=\"secondary\"]/b/following-sibling::a[1]|//table[@id='page-break']/tbody/tr/td/p/a[img/@src='/images/arrows/arrows-66.gif' and img/@alt='arrow']", | |
| "wedata.net.id":505 | |
| }, | |
| { | |
| "url":"^http://(?:ninjin[^./]*|(?:www\\.)?wolfg)\\.x0\\.com/(?:wolf[^/?#]*/)?(?:index\\.rb)?\\?", | |
| "insertBefore":"//div[contains(@class, \"footer\")]", | |
| "pageElement":"//div[contains(@class, \"main\")]", | |
| "nextLink":"//div[contains(@class, \"main\")]/a[last()]", | |
| "wedata.net.id":742 | |
| }, | |
| { | |
| "url":"^https?://(www\\.)?(thecelebritycafe|bitethebuzz|thedailyfever|twinfinite)\\.(com|net)/", | |
| "pageElement":"//div[@class='row listing' or @class='td-block-row' or @class='item-isotope']|//div[@class='theiaPostSlider_slides']/div/*[not(span/em or starts-with(@class,'code-block code-block'))]", | |
| "nextLink":"//a[@class='next page-numbers' or @class='_button _next' or i/@class='td-icon-menu-right']", | |
| "wedata.net.id":77277 | |
| }, | |
| { | |
| "url":"^http://([^.]+\\.keizai\\.biz|www\\.(hama|shibu)kei\\.com)/((headline)?/photo(flash)?)/", | |
| "pageElement":"id('entry')", | |
| "nextLink":"//li[@class='next_link']/a", | |
| "wedata.net.id":29649 | |
| }, | |
| { | |
| "url":"^http://www\\.sneakerbunko\\.jp/special/kyoko-sacrifice/(?:s2_)?\\d{2}-p\\d{1,2}\\.php", | |
| "pageElement":"id(\"main\")/article/*[not(self::h1)]", | |
| "nextLink":"//map/area[@alt=\"次へ\"]", | |
| "wedata.net.id":62559 | |
| }, | |
| { | |
| "url":"^http://chiebukuro\\.yahoo\\.co\\.jp/my/myspace_(?:(?:ans|que)detail|collection)\\.php", | |
| "pageElement":"id(\"myList\")/li", | |
| "nextLink":"id(\"yschpg\")//span[.=\">\"]/parent::a", | |
| "wedata.net.id":1423 | |
| }, | |
| { | |
| "url":"^http://news\\.mynavi\\.jp/series/workegypt/|^http://news\\.mynavi\\.jp/column/danpan/", | |
| "pageElement":"//div[contains(@class,\"center\")][.//img[contains(@src,\"images/001.jpg\") or contains(@src,\"images/002.jpg\") or contains(@src,\"images/003.jpg\") or contains(@src,\"images/004.jpg\")]]|//div[contains(@class,\"center\")][.//img[contains(@src,\"images/001.jpg\") or contains(@src,\"images/002.jpg\") or contains(@src,\"images/003.jpg\") or contains(@src,\"images/004.jpg\")]]/following-sibling::*[self::p[./node()] or self::h3]|//p[@class=\"lyt-hdg-03-03\"]", | |
| "nextLink":"//link[@rel=\"next\"]", | |
| "wedata.net.id":80858 | |
| }, | |
| { | |
| "url":"^http://(?:(?:.*\\.)?(?:gel|safe|mspa|x)?booru\\.(?:com|org)|tbib\\.org|rule34\\.xxx)/", | |
| "pageElement":"id(\"post-list\")//span[@class=\"thumb\"]|id(\"comment-list\")/div[@class=\"post\"]|//table[@class=\"highlightable\"]//tr", | |
| "nextLink":"id(\"paginator\")//a[@alt=\"next\"]", | |
| "wedata.net.id":74644 | |
| }, | |
| { | |
| "url":"^https?://.+?((free)?forum|/viewforum\\.php\\?|foro|/f/\\d+/|4allmobile|gurugossiper)", | |
| "pageElement":"//div[starts-with(@class,'forumbg') or @class='forabg'][last()]//ul[starts-with(@class,'topiclist topics')]/li[normalize-space(@class)='row bg1' or normalize-space(@class)='row bg2' or @class='row On' or @class='row Off' or starts-with(@class,'row row')][not(div/@class='topic-actions')]|//table[@id='content'][.//td/@id='canvas-panel']|//table[@class='forumline']//tr[starts-with(td/@class,'row')][not(td/span/b='Announcement:')]|id('pagecontent')//table[@class='tablebg']//tr[td[@class='row1' or @class='topic-titles row2']][not(.//img[contains(@src,'announce')])]|//tr[td[starts-with(@class,'row3')]/b='Topics']/following-sibling::tr[starts-with(td/@class,'row1')]|//tbody[tr/td/@class='tcl']|//div[starts-with(@class,'small-icon row bg')]|id('ModuleThreadList')//tr[td]", | |
| "nextLink":"(//*[@class='gensmall']/b/*[self::b or self::strong]|//table/tbody/tr/td[@class='nav'][last()]/b[last()]|(//div[@class='pagination']/span|//p[@class='pagelink conl'])/strong|//ul[@class='pn']/li[span/@class='curr'])/following-sibling::a[1]|(//link|//a)[.='Next' or @rel='next']", | |
| "wedata.net.id":27333 | |
| }, | |
| { | |
| "url":"^http://events\\.php\\.gr\\.jp/(?:events(?:/(?:index(?:/(?:page(?::\\d*)?)?)?)?)?)?$", | |
| "pageElement":"//div[@id='content']/div/*[not(@class='pager')][preceding-sibling::h2]", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":1572 | |
| }, | |
| { | |
| "url":"http://www\\.is\\.tohoku\\.ac\\.jp/jp/news/([a-zA-Z0-9_]+/)?(---pageid-\\d+\\.html)?", | |
| "pageElement":"//ul[@class='news_box list']/li|//table[@class='award-table horizon']//tr", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":80772 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?morimorisozai\\.net/(?:photo/photo|(?:image|material)_tag)\\.php", | |
| "pageElement":"id(\"main\")//table", | |
| "nextLink":"id(\"main\")/p/a[preceding-sibling::b or img[@alt=\"\u6b21\u306e\u30da\u30fc\u30b8\"]]", | |
| "wedata.net.id":30908 | |
| }, | |
| { | |
| "url":"^http://news\\.mynavi\\.jp/series/futari/|^http://news\\.mynavi\\.jp/column/komugi/", | |
| "pageElement":"//div[contains(@class,\"center\")][1]|//div[contains(@class,\"center\")][1]/following-sibling::p[1]|//div[contains(@class,\"center\")][1]/preceding-sibling::p|//div[contains(@class,\"center\")][1]/following-sibling::p[2][//link[@rel=\"canonical\"][@href=\"http://news.mynavi.jp/column/komugi/001/\"]]|//p[@class=\"lyt-hdg-03-03\"]", | |
| "nextLink":"//link[@rel=\"next\"]", | |
| "wedata.net.id":80807 | |
| }, | |
| { | |
| "url":"^http://(?:bestgm|bestjd|bestjp|evon|hgc|sky)\\.bestiz\\.net/zboard/zboard\\.php\\?", | |
| "pageElement":"//tr[td/@class='listnum']", | |
| "nextLink":"//b[number(.)>0]/following-sibling::a[1]", | |
| "wedata.net.id":54211 | |
| }, | |
| { | |
| "url":"^http://www\\.june-net\\.com/shop/(?:(?:comics|authors)_list|cdvideo|novels)\\.html", | |
| "pageElement":"//div[@class=\"page\"][1]/following-sibling::div[contains(@id, \"list\")]", | |
| "nextLink":"//a[img[@alt=\"次へ\"] or text()=\"次のページへ\"]", | |
| "wedata.net.id":63188 | |
| }, | |
| { | |
| "url":"^http://(?:www|school)\\.(?:cw|parenting|commonhealth|cheers)\\.com\\.tw//?article", | |
| "pageElement":"//div[@*='cp' or @class='commonArticle'] | id('testPagLever')/preceding-sibling::p", | |
| "nextLink":"//a[.='下一頁']", | |
| "wedata.net.id":73907 | |
| }, | |
| { | |
| "url":"^http://www\\.neostaff\\.co\\.jp/jazzpiano/(?:lesson|special)_(?:a_)?\\d{3}\\.html", | |
| "pageElement":"id('main')/hr/preceding-sibling::*[not(@id='mainPath')]", | |
| "nextLink":"id('main')/p[@class='textCenter']/a[.='次のページ']", | |
| "wedata.net.id":43377 | |
| }, | |
| { | |
| "url":"^http://image\\.itmedia\\.co\\.jp/(?:(?!articles/)[^/?#]+/)+articles/[^.?#]+\\.jpg", | |
| "pageElement":"id(\"imgMain\")", | |
| "nextLink":"id(\"imgBtnRight\")/a", | |
| "wedata.net.id":54654 | |
| }, | |
| { | |
| "url":"^https://search\\.sbisec\\.co\\.jp/v2/popwin/tools/yutai/yutai_search_c\\d+\\.html", | |
| "pageElement":"//tr[@class='tbh']/following-sibling::tr", | |
| "nextLink":"//a[u='次へ→']", | |
| "wedata.net.id":2487 | |
| }, | |
| { | |
| "url":"^http://dic\\.pixiv\\.net/(?:$|category|new(?:article|update)s|search|\\?page=\\d)", | |
| "pageElement":"id(\"main\")/section", | |
| "nextLink":"id(\"main\")/footer/a", | |
| "wedata.net.id":54762 | |
| }, | |
| { | |
| "url":"^http://www\\.ab\\.cyberhome\\.ne\\.jp/~thursdayairship/comic/(?:\\w+)?\\d+\\.html", | |
| "pageElement":"//center/*", | |
| "nextLink":"id(\"_HPB_TABLE_3_B_080105231545\")//a[img]", | |
| "wedata.net.id":39515 | |
| }, | |
| { | |
| "url":"^http://spibal\\.webclap\\.com/(?:community|followed_team|illust_club|news)\\.html", | |
| "pageElement":"id('contents')//table//tr[//img[@class='js_rollover']]|id('contents')/div[contains(concat(' ',@class,' '),' left_column ')]/div[table]/div[img]/following-sibling::*", | |
| "nextLink":"//a[contains(img/@src,'./illust_club/img/page_next.gif')]|//div/b[number(translate(.,'[]',''))>0]/following-sibling::a|//td/a[contains(.,'>>')]", | |
| "wedata.net.id":55125 | |
| }, | |
| { | |
| "url":"^http://blog-imgs-\\d+(?:-origin)?\\.fc2\\.com/b/o/u/bounohito/zerosA?\\d+\\.html", | |
| "pageElement":"//table[1]", | |
| "nextLink":"//center[1]/a[last()]", | |
| "wedata.net.id":55860 | |
| }, | |
| { | |
| "url":"^http://natalie\\.mu/(?:[^/]+/)*?(?:artist|(?:site)?news|pp|work|gallery/hot|tag)", | |
| "pageElement":"id(\"NA_main\")//ul[contains(concat(\" \",@class,\" \"),\" NA_articleList \") or contains(concat(\" \",@class,\" \"),\" NA_imageList \") or contains(concat(\" \",@class,\" \"),\" NA_artistList \")]/li", | |
| "nextLink":"//li[@class=\"NA_next\"]/a", | |
| "wedata.net.id":29499 | |
| }, | |
| { | |
| "url":"^http://www\\.cmn\\.hs\\.h\\.kyoto-u\\.ac\\.jp/CMN4/sympo.files/symposium\\d.html", | |
| "pageElement":"//*[./a[contains(@href,\"default3.html\")]]/preceding-sibling::*[not(self::center)]", | |
| "nextLink":"//a[text()=\"次ページ→\"]", | |
| "wedata.net.id":76414 | |
| }, | |
| { | |
| "url":"^http://park6\\.wakwak\\.com/~blanc-noir/contents/comic/\\w+/(?:\\w+)?\\d+\\.html", | |
| "pageElement":"//*[following-sibling::table]", | |
| "nextLink":"//table/descendant::td[last()]/a[last()][text()=\"NextPage\u2192\" or not(starts-with(@href, \"000\"))][text()!=\"\u2190PrePage\"]", | |
| "wedata.net.id":40857 | |
| }, | |
| { | |
| "url":"^http://www8\\.plala\\.or\\.jp/yuugizyou/harannoroltuka/harannoroltuka\\d+\\.html", | |
| "pageElement":"//p[1]", | |
| "nextLink":"//a[last()]", | |
| "wedata.net.id":40728 | |
| }, | |
| { | |
| "url":"^https?://[^./]+\\.amazon(?:\\.[^./]{2,3}){1,2}/(?:gp/)?(?:best|mo(?:st|ve)|new)", | |
| "pageElement":"//div[@class='zg_itemRow']", | |
| "nextLink":"//li[@class='zg_page zg_selected']/following-sibling::li[1]/a", | |
| "wedata.net.id":876 | |
| }, | |
| { | |
| "url":"^http://www\\.doujinnet\\.net/contents/[^/?#]+/(?:[^/?#]+/\\d+|index\\d*)\\.html", | |
| "pageElement":"id(\"page_img\")/a|id(\"rightcolumn\")/table", | |
| "nextLink":"//div[@id=\"next\"]/a|//td[contains(.//img/@src,\"num/here\")]/following-sibling::td/div/a", | |
| "wedata.net.id":55497 | |
| }, | |
| { | |
| "url":"^http://www\\.toranoana\\.jp/(?:mailorder/\\w+|bl/bok)/m_pagekit/toku_navi_\\w+/", | |
| "pageElement":"id(\"main\")/table[@cellspacing and not(@summary)]//tr[not(./td[@colspan])]", | |
| "nextLink":"//a[normalize-space()=\"次のページへ>>\"]", | |
| "wedata.net.id":77736 | |
| }, | |
| { | |
| "url":"^https?://userscripts(-mirror)?\\.org/(?:(?:forum|tag|user)s/|(?:script|topic)s)", | |
| "pageElement":"id('content')/table/tbody/tr[td[@class='c2' or @class='script-meat' or contains(a/@href,'tags')]]|id('main')/table[@class='posts wide']|id('review-list')", | |
| "nextLink":"id('content main')/div[@class='pagination']/a[contains(@rel,'next')]", | |
| "wedata.net.id":684 | |
| }, | |
| { | |
| "url":"^http://www\\.moeyo\\.com/\\d+/\\d+/(?:_no|4koma_(?:nagano|kitamine))\\d+\\.html", | |
| "pageElement":"id(\"content\")//div[@class=\"entry-more\"]//tr", | |
| "nextLink":"//a[descendant::img[@src=\"http://www.moeyo.com/blogparts/go.gif\"]]", | |
| "wedata.net.id":31316 | |
| }, | |
| { | |
| "url":"^http://www\\.biwa\\.ne\\.jp/~coo-mail/usumaku/\\w+/[a-z_]+\\d+(?:_\\d+)?\\.html", | |
| "pageElement":"//center/*[self::table or self::p[preceding-sibling::table]]", | |
| "nextLink":"//a[contains(., \"Next\") or .=\"\u6700\u7d42\u8a71\" or (.=\"\u3042\u3068\u304c\u304d\" and preceding-sibling::a[contains(., \"Back\")])]", | |
| "wedata.net.id":41252 | |
| }, | |
| { | |
| "url":"^http://www\\.koike-shoin\\.co\\.jp/shopping/prg/search\\.cgi\\?(?!mode=details)", | |
| "pageElement":"//table[@width=\"758\"]/following-sibling::table[@width=\"650\" and .//font[@class=\"KB12\"]]", | |
| "nextLink":"//a[text()=\"次の10件\"]", | |
| "wedata.net.id":65370 | |
| }, | |
| { | |
| "url":"^http://qdb\\.us/(?:$|best|bottom|latest|leetness|queue|random|today|top|worst)", | |
| "pageElement":"id(\"vt\")//tr[td[contains(concat(\" \", @class, \" \"), \" q \")]]", | |
| "nextLink":"id(\"vt\")//span[contains(concat(\" \", @class, \" \"), \" pg \")]/a[.=\"Next>\"]", | |
| "wedata.net.id":49476 | |
| }, | |
| { | |
| "url":"^http://(?:(?:boatingsavings|w(?:ww|orkwearsavings))\\.)?sportsmansguide\\.com/", | |
| "pageElement":"id('product-listing-container')/ol", | |
| "nextLink":"//a[@class='control next']", | |
| "wedata.net.id":32450 | |
| }, | |
| { | |
| "url":"^https?://www\\.3dcg-arts\\.net/(?:legacy-system/arts|favorite/contents|search)", | |
| "pageElement":"id('metadata')/*", | |
| "nextLink":"id('windowDefaultShow')[1]/table/tbody/tr/td[3]/a", | |
| "wedata.net.id":62156 | |
| }, | |
| { | |
| "url":"^http://(?:rurema\\.clear-code\\.com/|docs\\.ruby-lang\\.org/(?:ja|en)/search/)", | |
| "pageElement":"//dl[@class='entries']/*", | |
| "nextLink":"//span[@class=\"paginate-current\"]/following-sibling::span[1]/a", | |
| "wedata.net.id":64696 | |
| }, | |
| { | |
| "url":"^http://(?:news|search|jobs|yellowpages)\\.lycos\\.(?:[^.]{2,3}\\.)?[^.]{2,3}/", | |
| "pageElement":"//div[@class='results search-results']/ul/li|id('jobs')/li", | |
| "nextLink":"//a[@title='Next' or @class='next']", | |
| "wedata.net.id":32413 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?(?:leoshop|toyking|zoids)\\.com\\.tw/shop/main\\d*\\.asp\\?", | |
| "pageElement":"//table[@class='incate']|//table[@class='incate']/following-sibling::br[1]", | |
| "nextLink":"//a[.='[下一頁]']", | |
| "wedata.net.id":55548 | |
| }, | |
| { | |
| "url":"^http://heppocology\\.fc2web\\.com/(?:neneko|kanokanowake|tonanenebangai|yaji)", | |
| "pageElement":"(//node()[self::p or self::center])[1] | (//node()[self::p or self::center])[1]/following-sibling::node()", | |
| "nextLink":"//a[contains(.,'NEXT')]", | |
| "wedata.net.id":33038 | |
| }, | |
| { | |
| "url":"^http://book\\.geocities\\.jp/dyyqf626/comic\\d+/(?!huyutubaki\\.index\\.htm)", | |
| "pageElement":"//p[@align=\"center\"]", | |
| "nextLink":"//a[img and not(contains(@href, \"comic.htm\"))]", | |
| "wedata.net.id":39788 | |
| }, | |
| { | |
| "url":"^https?://www\\.flickr\\.com/photos/[^/?#]+/archives/date-taken(?:/\\d+){0,3}", | |
| "pageElement":"id('photo-display-container')/*", | |
| "nextLink":"//a[@class='Next rapidnofollow']", | |
| "wedata.net.id":54663 | |
| }, | |
| { | |
| "url":"^https?://(?:c(?:areer|ode)|enterprise|m(?:arke|oney))zine\\.jp/(news|search)", | |
| "pageElement":"//section[@class=\"newsBlock\"][./ul]|//ul[@class=\"catTopList cf\"]", | |
| "nextLink":"//a[@rel=\"next\" or ../@class=\"nextBtn\"]", | |
| "wedata.net.id":77467 | |
| }, | |
| { | |
| "url":"^http://(?:forums|otn)\\.oracle\\.co(?:m|\\.jp)/forums?/(forum|thread)\\.jspa", | |
| "pageElement":"//div[@class='jive-message-list'][.//tbody]|//div[@class='jive-table']/table/tbody", | |
| "nextLink":"//a[.='Next' or .='次へ']", | |
| "wedata.net.id":2478 | |
| }, | |
| { | |
| "url":"^http://(?:[^.]+\\.keizai\\.biz|www\\.(?:hama|shibu)kei\\.com)/[^/]/archives/", | |
| "pageElement":"(id('entry')|//div[@class='list_area'])/*/*", | |
| "nextLink":"id('pageswitch')/a[.='次へ']", | |
| "wedata.net.id":25933 | |
| }, | |
| { | |
| "url":"^http://www\\.flickr\\.com/photos/[^/?#]+/sets/(?![^/?#]+/detail(?:[/?#]|$))", | |
| "pageElement":"id(\"photo-display-container\")/*", | |
| "nextLink":"id(\"paginator-module\")/descendant::a[contains(concat(\" \", @class, \" \"), \" Next \")]", | |
| "wedata.net.id":460 | |
| }, | |
| { | |
| "url":"^https://www\\.iy-net\\.jp/nsmarket/(get[a-z]*products|searchresult)\\.do\\?", | |
| "pageElement":"//section[@class='colmainarea']/ul/li", | |
| "nextLink":"//li[contains(@class,'nextitem')]/a", | |
| "wedata.net.id":1598 | |
| }, | |
| { | |
| "url":"^http://www\\.taipeimarathon\\.org\\.tw/forum/forum_(?:post|topic)s\\.asp\\?", | |
| "pageElement":"//tr[@class='tableLedger']/following-sibling::tr[not(@class='tableSubLedger')]", | |
| "nextLink":"//a[@title='下個月 頁面']", | |
| "wedata.net.id":31148 | |
| }, | |
| { | |
| "url":"^https?://netsuper\\.aeon\\.jp/(?:[^/]+/)?[^/]+/shop/category_list\\.aspx\\?", | |
| "pageElement":"id(\"_ctl9_ProductImageList\")/*", | |
| "nextLink":"id(\"_ctl9_PagerU__ctl0_lnkNext\")[@href]", | |
| "wedata.net.id":32833 | |
| }, | |
| { | |
| "url":"^http://data\\.ichijinsha\\.co\\.jp/book/booksearch/booksearch_list\\.php\\?", | |
| "pageElement":"//div[@class=\"book\" or @class=\"line\" or @class=\"space\"]", | |
| "nextLink":"//div[@class='txtnavi']/ul/li[@class='last']/a", | |
| "wedata.net.id":64685 | |
| }, | |
| { | |
| "url":"^http://web\\.archive\\.org/.*/http://(?:www\\.)?diveintogreasemonkey\\.org/", | |
| "pageElement":"//div[@class=\"section\" or @class=\"chapter\" or @class=\"book\"]", | |
| "nextLink":"//div[contains(text(), \"→\")]/a", | |
| "wedata.net.id":26423 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?(giantbomb|tested|screened|animevice|comicvine)\\.com/.+", | |
| "pageElement":"id('river js-sort-filter-results video-block')/ul/li|//table[contains(@class,'table-forums')]//tr[td]|//div[starts-with(@id,'js-message-')]", | |
| "nextLink":"//li[@class='paginate__item skip next']/a", | |
| "wedata.net.id":53167 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?peniscult\\.com/(?:top-rated|big-cock(?:/[^/]*)?)/[^/]*$", | |
| "pageElement":"//ul[@class=\"models\"]", | |
| "nextLink":"//li[@class=\"active\"]/following-sibling::li[1]/a", | |
| "wedata.net.id":53001 | |
| }, | |
| { | |
| "url":"^http://blog-imgs-\\d+-origin\\.fc2\\.com/b/o/u/bounohito/zeroA?\\d+\\.html", | |
| "pageElement":"//table[1]", | |
| "nextLink":"//center[1]/a[last()]", | |
| "wedata.net.id":39553 | |
| }, | |
| { | |
| "url":"^http://(www|skygarden|sol-comics|(sokuy|shinc)omi)\\.shogakukan\\.co\\.jp/", | |
| "pageElement":"//tr[./td[@class='SearchResultVline']][1]|//tr[./td[@class='SearchResultVline']][1]/following-sibling::tr|//ul[@class='bookBoxIn01' or @class='ul_news01']/li|id('manga')", | |
| "nextLink":"(//*[contains(@class,'SearchResultNext') or contains(@class,'next01')]|id('next'))/a", | |
| "wedata.net.id":63194 | |
| }, | |
| { | |
| "url":"^https?://(www\\.)?300mb(films\\.co|united\\.me|links\\.net|hdmovies\\.com)", | |
| "pageElement":"//div[@class='post' or @class='blogpostcategory' or starts-with(@id,'post-')]|//div[@class='azindex']/ul/li", | |
| "nextLink":"//li[@class='active_page']/following-sibling::li[1]/a|//span[@class='azlink azdisabled']/following-sibling::span[1]/a|//a[div/@class='left' or @class='nextpostslink']", | |
| "wedata.net.id":66758 | |
| }, | |
| { | |
| "url":"^https?://groups\\.google\\.(?:[^.]{2,3}\\.)?[^./]{2,3}/group/[^/]+/search", | |
| "pageElement":"//td[contains(@class,\"overflow-hide\")]/*", | |
| "nextLink":"id(\"bottom_marker\")/descendant::a[last()]", | |
| "wedata.net.id":478 | |
| }, | |
| { | |
| "url":"^http://((?:green|blog)\\.)?search\\.goo\\.ne\\.jp/(?:search|web\\.jsp)\\?", | |
| "pageElement":"//div[@class='result']", | |
| "nextLink":"//ol[@class='fsL1 clearfix']/li[span[not(a)]]/following-sibling::li[1]/span/a", | |
| "wedata.net.id":632 | |
| }, | |
| { | |
| "url":"^http://(?:(?:www|gold)\\.)?darkthrone\\.com/(?:forum/|userlist/attack\\?)", | |
| "pageElement":"(id(\"pmt user_list\")|//table[@class=\"thread\"])/tbody/tr[./td]", | |
| "nextLink":"//a[@class=\"nav\" and .=\"Next\"]|//span[@class=\"current\"]/following-sibling::a[1]", | |
| "wedata.net.id":2566 | |
| }, | |
| { | |
| "url":"^https://www\\.gay-torrents\\.net/(:?latest|torrents(?:list|search)\\.php)", | |
| "pageElement":"//div[@id='torrent-list'][2]/following-sibling::div/div/ul", | |
| "nextLink":"//span[@class='selected']/following-sibling::span[1]/a", | |
| "wedata.net.id":73801 | |
| }, | |
| { | |
| "url":"^http://jp\\.xinhuanet\\.com/\\d{4}-\\d{2}/\\d{1,2}/c_\\d{9}(_\\d+)?\\.htm", | |
| "pageElement":"//div[@class=\"fontbox\"]//span[@class=\"dask\"]/img|//div[@class=\"fontsizebox\"][not(.//span[@class=\"dask\"])]/p[@align=\"center\"]/img", | |
| "nextLink":"//a[./img[@class=\"abc\"]][last()]", | |
| "wedata.net.id":63626 | |
| }, | |
| { | |
| "url":"^http://allabout\\.co\\.jp/gm/(gc|gp|gl)|^http://allabout\\.co\\.jp/recipe", | |
| "pageElement":"//div[@class=\"article-list\"]//li|id(\"popin_read\")|//main[@class=\"aa_main\"]//ul[@class=\"aa_media-list\"]/li", | |
| "nextLink":"//a[(text()=\"次のページへ\")]", | |
| "wedata.net.id":72582 | |
| }, | |
| { | |
| "url":"^http://www\\.tomshardware\\.com/(?:(?:articl|news|reviews)/|search\\.php)", | |
| "pageElement":"//div[@class='unit lastUnit leftsep innerL10 results' or starts-with(@class,'resultContainer')]/ul/li", | |
| "nextLink":"//a[span/span/@class='ib picto next']", | |
| "wedata.net.id":1865 | |
| }, | |
| { | |
| "url":"^https?://(?:www|cnweb)\\.bing\\.com/(?:[^/]+/)*?(?:results\\.aspx|search)", | |
| "pageElement":"id(\"b_results\")/li[@class=\"b_algo\"]|id(\"results\")", | |
| "nextLink":"//a[@class=\"sb_pagN\"]", | |
| "wedata.net.id":501 | |
| }, | |
| { | |
| "url":"^https?://musicbrainz\\.org/artist/[0-9a-f-]{36}(\\?.*\\bpage=\\d+\\b.*)?$", | |
| "pageElement":"id(\"content\")/form/*[local-name(.)!=\"nav\"]", | |
| "nextLink":"//nav/ul[@class=\"pagination\"]/li[last()]/a", | |
| "wedata.net.id":64851 | |
| }, | |
| { | |
| "url":"^https://webcatalog(-free)?\\.circle\\.ms/(User|Circle|Search|Book|Booth)", | |
| "pageElement":"//table[contains(concat(' ',normalize-space(@class),' '), ' md-infotable ') or contains(concat(' ',normalize-space(@class),' '), ' c-table--list ')]/tbody/tr[td] | //div[@class='md-genre'] | //div[@class='md-maparea']/following-sibling::node()[1] | //ul[contains(concat(' ',@class,' '),' genre-list ') or @class='m-boothlist']/li", | |
| "nextLink":"//ol[contains(concat(' ',@class,' '),' m-pagination-list ')]/li[number(.) > 0]/following-sibling::li/a", | |
| "wedata.net.id":65155 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?boxofficemojo\\.com/(news|alltime|yearly|week(end|ly))", | |
| "pageElement":"//tr[@bgcolor='#dcdcdc']/following-sibling::tr[td//font/a]", | |
| "nextLink":"//b/font/following-sibling::a|//td/a[font='Next Page >>']", | |
| "wedata.net.id":74677 | |
| }, | |
| { | |
| "url":"^http://dic\\.nicovideo\\.jp/(?:m/[nu]|s)/(?:[aciluv]|all|al|oekaki|mml)/", | |
| "pageElement":"id(\"main\")//div[@class=\"article\"]/table[@class=\"menulist\" or @class=\"oekaki-list\"]//tr[td]", | |
| "nextLink":"id(\"main\")//div[@class=\"article\"]/div[@class=\"pager\"]/a[last()][@class=\"navi\"]", | |
| "wedata.net.id":1567 | |
| }, | |
| { | |
| "url":"^http://natalie\\.mu/(?:(?:(?:com|mus)ic|eiga|o(?:yatsu|warai))/)?pp/[^/]", | |
| "pageElement":"id('sp-left')/div[starts-with(@class,'sp-navigation')]/following-sibling::div[following-sibling::div[@class='sp-link-next' or @class='sp-navigation' or (contains(@class,'sp-footer-navigation') and not(//div/@class='sp-link-next'))]]", | |
| "nextLink":"//li[@class='sp-tab-next']/a", | |
| "wedata.net.id":33439 | |
| }, | |
| { | |
| "url":"^http://(?:rou\\.0ch\\.cx|rou0ch\\.s314\\.xrea\\.com)/.+/comic\\d+\\.html", | |
| "pageElement":"//b[not(parent::div)]/following-sibling::* | //div/*[not(self::b)]", | |
| "nextLink":"//a[img[contains(concat(\" \", @class, \" \"), \" img \")]]", | |
| "wedata.net.id":38236 | |
| }, | |
| { | |
| "url":"^https?://tech-seminar\\.jp/(?:$|seminar|publication|tag|taxonomy|admin)", | |
| "pageElement":"id('squeeze')//div[@class='view-content']/div[contains(concat(' ', @class, ' '), ' views-row ')]|id('squeeze')//form/div/table", | |
| "nextLink":"//*[@class='more-link' or @class='pager-next']/a", | |
| "wedata.net.id":30708 | |
| }, | |
| { | |
| "url":"^http://www\\.ravelry\\.com/(?:d(?:esigner|iscus)|pattern|project|yarn)s", | |
| "pageElement":"id(\"content designers people_panel search_results\")/div[@class=\"page_links\"][1]/following-sibling::div[./following-sibling::div[@class=\"page_links\"]]|//div[@class=\"activity\" or @class=\"topic_glance\" or @class=\"post\"]|id(\"forum_posts\")/tbody/tr[./td[@class=\"who\"]]|id(\"designer_patterns\")/tbody/tr", | |
| "nextLink":"//div[@class=\"pagination\"]/text()[number()=normalize-space()]/following-sibling::a[1]", | |
| "wedata.net.id":32388 | |
| }, | |
| { | |
| "url":"^https?://(?:[^.]+\\.(?:redhat\\.com|centos\\.org)/(documentation|docs))", | |
| "pageElement":"//div[@class='book' or @class='chapter' or @class='section' or @class='preface' or @class='part' or @class='toc' or @class='appendix']|//div[@class='NAVHEADER']/following-sibling::*[following-sibling::div[@class='NAVFOOTER']]", | |
| "nextLink":"//li[@class='next']/a||//a[@accesskey='N']", | |
| "wedata.net.id":674 | |
| }, | |
| { | |
| "url":"^http://www\\.ranking-gogo\\.net/(search|products/view|categories/rank)/", | |
| "pageElement":"//div[@class='thnbox60 clearfix' or @class='goodbox clearfix' or @class='catRankbox']", | |
| "nextLink":"//a[@class='paging_inner'][contains(.,'次の')]", | |
| "wedata.net.id":65268 | |
| }, | |
| { | |
| "url":"^http://community\\.livejournal\\.com/vintagephoto/\\d{4}/\\d{2}/\\d{2}/", | |
| "pageElement":"//div[@class='day']", | |
| "nextLink":"id('skiplinks')/li[last()]/a", | |
| "wedata.net.id":562 | |
| }, | |
| { | |
| "url":"^http://.*(bizmakoto|eetimes|(atmarkit|itmedia|ednjapan)\\.co)(m|\\.jp)/", | |
| "pageElement":"((//div[@class='inner']|id('article_body'))//*[@class='ctrl' or @class='endkwd'][last()]|id('main-contents')/div[@class='nextprev'])/preceding-sibling::*[not(@id='masterSocialbuttonTop' or @class='ctrl' or @class='endkwd' or @id='fb-root' or @id='ITOT1' or @id='TABLETAD' or @id='cmsMark' or name()='script' or name()='link' or @class='shopbtn' or @id='ITR')]|id('centercol')/*[preceding-sibling::table//div/font/b[contains(.,'Page')] or preceding-sibling::font/@size='2'][following-sibling::ul[last()] or following-sibling::table//img[contains(@src,'next')]]|id('centercol')/ul[last()]/*[following-sibling::table//img[contains(@src,'next')]]|//p[@class='bakLink']/preceding-sibling::*|//div[@class='headset']/*[not(p/@class='bakLink')]", | |
| "nextLink":"id('next')/a|id('centercol')//a[contains(img/@src,'next')]", | |
| "wedata.net.id":64248 | |
| }, | |
| { | |
| "url":"^https?://www\\.xiami\\.com/space/(?:collect|lib-(?:song|album|artist))", | |
| "pageElement":"//table[@class='track_list']/tbody/tr[td]|//div[@class='albumThread_list library_album' or @class='albumBlock_list library_album' or @class='artistThread_list library_artist' or @class='artistBlock_list library_artist' or @class='collectBlock_listNew common_sec3 pool10 blank10' or @class='collectThread_list common_sec3 pool10 blank10']", | |
| "nextLink":"//a[@class='p_redirect_l']", | |
| "wedata.net.id":73778 | |
| }, | |
| { | |
| "url":"^http://www\\.takaratomy\\.co\\.jp/products/wixoss/card/card_list\\.php", | |
| "pageElement":"id(\"card_caption\")/following-sibling::tr", | |
| "nextLink":"//ul/li[a/@class=\"page_now\"]/following-sibling::li/a", | |
| "wedata.net.id":76398 | |
| }, | |
| { | |
| "url":"^https?://(?:ap|emea|na[1-6]|ssl)\\.salesforce\\.com/[0-9a-zA-Z]{3}[/?]", | |
| "pageElement":"id(\"bodyCell\")//div[contains(concat(\" \",@class,\" \"),\" bPageBlock \")]//table[1]", | |
| "nextLink":"id(\"bodyCell\")/div[contains(concat(\" \",@class,\" \"),\" bNext \")]//div[contains(concat(\" \",@class,\" \"),\" next \")]/a[last()]", | |
| "wedata.net.id":534 | |
| }, | |
| { | |
| "url":"^http://(?:www|entertainment|women|technology)\\.timesonline\\.co\\.uk/", | |
| "pageElement":"//div[@class=\"pagination-center\"]/following-sibling::node()[1]/preceding-sibling::*", | |
| "nextLink":"//a[contains(concat(\" \", @class, \" \"), \" next \")]", | |
| "wedata.net.id":2575 | |
| }, | |
| { | |
| "url":"^http://(sports|baseball)\\.yahoo\\.co\\.jp/(news|video|blog|japan|mlb)", | |
| "pageElement":"(id('ListType')|//ul[@class='glanceArticleBox' or @class='newsList'])/li|//div[@class='mainSection']", | |
| "nextLink":"//a[.='次へ' or .='次 >']", | |
| "wedata.net.id":76256 | |
| }, | |
| { | |
| "url":"^http://www\\.geocities\\.jp/konoatusa(?:\\d+)?/comic/(?:\\d+|prologue)", | |
| "pageElement":"//br[1]/following-sibling::node()", | |
| "nextLink":"//a[last() and not(contains(@href,\"inside\")) and .!=\"戻る\"]", | |
| "wedata.net.id":55435 | |
| }, | |
| { | |
| "url":"^http://member\\.jp\\.square-enix\\.com/(topics|information|community)/", | |
| "pageElement":"id('topicsList')/li|//ul[@class='information_list']/li|id('circleList categorySearchList')/div[contains(@class,'searchListBox')]", | |
| "nextLink":"//li[@class=\"number\"][./span]/following-sibling::li[1]/a|//span[@class=\"current\"]/following-sibling::a[1]", | |
| "wedata.net.id":65371 | |
| }, | |
| { | |
| "url":"^https?://www\\.tumblr\\.com/(?:dashboard|blog|tagged|like|show)/\\d+/-", | |
| "pageElement":"id('posts')/li[starts-with(div/@id, 'post_')]", | |
| "nextLink":"id('previous_page_link')", | |
| "wedata.net.id":2424 | |
| }, | |
| { | |
| "url":"^http://([^.]+\\.)?(?:crunchgear|mobilecrunch|techcrunch(?:it)?)\\.com/", | |
| "pageElement":"//div[starts-with(@class,'l-main')]/ul/li", | |
| "nextLink":"//a[span/@class='icon-video-play next' or ../@class='next']", | |
| "wedata.net.id":546 | |
| }, | |
| { | |
| "url":"^http://asahi\\.co\\.jp/php/precure_heartcatch/bbs/view\\.php(?:\\?|$)", | |
| "pageElement":"//div[@class=\"user\"]", | |
| "nextLink":"//div[@class=\"next\"]/a", | |
| "wedata.net.id":26971 | |
| }, | |
| { | |
| "url":"^https://www\\.amazon\\.co\\.jp/gp/css/history(?:/orders)?/view\\.html", | |
| "pageElement":"id(\"cs-orders\")/div[@class=\"action-box rounded\"]", | |
| "nextLink":"id(\"cs-orders\")/div/div/div/a[.=\"\u6b21\u3078 \u00bb\"]", | |
| "wedata.net.id":2351 | |
| }, | |
| { | |
| "url":"^https://www\\..+-(apps|games|addons|look|themes|stuff|artwork)\\.org/", | |
| "pageElement":"//div[@class='product-list']/*", | |
| "nextLink":"//li[@class='next ']/a", | |
| "wedata.net.id":77371 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?appshopper\\.com/(?!.*(blog|bestsellers|profile)).*", | |
| "pageElement":"//ul[@class=\"appdetails\"]", | |
| "nextLink":"//div[@class=\"pages\"]/a[last()]", | |
| "wedata.net.id":74104 | |
| }, | |
| { | |
| "url":"^http://www\\.akatsuki-novels\\.com/stories/view/\\d+/novel_id[:~]\\d+", | |
| "pageElement":"id('contents-inner2')//h2|id('contents-inner2')//hr|//div[contains(\" body-novel paging_for_view \",concat(\" \",@class,\" \"))]", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":62423 | |
| }, | |
| { | |
| "url":"^http://www\\.enecho\\.meti\\.go\\.jp/about/whitepaper/2009commentary/", | |
| "pageElement":"id('main')/*[not(@class='aCenter mt30' or @id='footlink')]", | |
| "nextLink":"id('main')//a[contains(.,'次の項目')]", | |
| "wedata.net.id":30119 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?goo-net\\.com/cgi-bin/fsearch/goo_used_search\\.cgi", | |
| "pageElement":"id('form1')/*", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":67232 | |
| }, | |
| { | |
| "url":"^http://www\\.gentosha-comics\\.net/(?:lynx|comiclynx|/?rutile)/choko/", | |
| "pageElement":"//div[@class=\"page\"]", | |
| "nextLink":"//a[contains(text(), \"NEXT\")]", | |
| "wedata.net.id":65637 | |
| }, | |
| { | |
| "url":"^http://xoops\\.ec-cube\\.net/modules/newbb/view(forum|topic)\\.php\\?", | |
| "pageElement":"id('content')//table[@class='outer']//tr[not(@class='head' or @class='foot' or th)]", | |
| "nextLink":"//span[@class='orange']/following-sibling::a[1]", | |
| "wedata.net.id":30653 | |
| }, | |
| { | |
| "url":"^http://news\\.mynavi\\.jp/series/(ikujisabaku|aruaru|madogiwablues)/", | |
| "pageElement":"//div[contains(@class,\"center\")][not(.//img[contains(@src,\"images/002.jpg\")])]|//div[contains(@class,\"center\")][not(.//img[contains(@src,\"images/002.jpg\")])]/following-sibling::*[self::p or self::h3]|//div[contains(@class,\"center\")][not(.//img[contains(@src,\"images/002.jpg\")])]/preceding-sibling::*[self::p or self::h3]|//p[@class=\"lyt-hdg-03-03\"]", | |
| "nextLink":"//link[@rel=\"next\"]", | |
| "wedata.net.id":80857 | |
| }, | |
| { | |
| "url":"^http://www\\.freedl\\.org/treebbs2rss/treebbs2rss/tree\\.php\\?mode=", | |
| "pageElement":"//a[table/@class='brdr']|//tr[@class='bgc']", | |
| "nextLink":"//a[.='次の 20 件' or .='次の 15 件']", | |
| "wedata.net.id":63264 | |
| }, | |
| { | |
| "url":"^http://wdoor\\.c\\.u-tokyo\\.ac\\.jp/shogi/view/latest\\-table\\.cgi", | |
| "pageElement":"//div[@class=\"summary\"]/table/tbody/tr[starts-with(@class,\"floodgate\")]", | |
| "nextLink":"//div/a[last()]", | |
| "wedata.net.id":74826 | |
| }, | |
| { | |
| "url":"^http://(?:www|a)\\.sofmap\\.com/(?:product_list|search_result)/exec/", | |
| "pageElement":"id('contents_main')/form/table[not(@class)]/tbody/tr", | |
| "nextLink":"id('contents_main')/form/preceding::a[.='次へ']", | |
| "wedata.net.id":2202 | |
| }, | |
| { | |
| "url":"^http://www\\.spotlight-jp\\.com/matsutake/mt/archives/\\d{4}/\\d{2}/", | |
| "pageElement":"id(\"content\")/*", | |
| "nextLink":"id(\"content\")/p/a[contains(text(), \"\u00bb\")]", | |
| "wedata.net.id":42126 | |
| }, | |
| { | |
| "url":"^http://www\\.careerbuilder\\.com/jobSeeker/jobs/jobresults\\.aspx\\?", | |
| "pageElement":"//table[@class='jl_tbl']/tbody/tr", | |
| "nextLink":"//a[@class='JL_MXDLPagination2_next']", | |
| "wedata.net.id":32565 | |
| }, | |
| { | |
| "url":"^http://shopdd\\.blog51\\.fc2\\.com/(?:$|page|blog-category|category)", | |
| "pageElement":"id('article_list')/*", | |
| "nextLink":"id('next')/a[last()]", | |
| "wedata.net.id":2048 | |
| }, | |
| { | |
| "url":"^http://www\\.mangareader\\.net/(?:\\d+-\\d+-\\d+/|[^/]+/\\d+(?:$|/))", | |
| "pageElement":"id('imgholder')/a[img]", | |
| "nextLink":"id('imgholder')/a[img]", | |
| "wedata.net.id":35727 | |
| }, | |
| { | |
| "url":"^http://www\\.bookoffonline\\.co\\.jp/disp/BSfDispBookMarkInfo\\.jsp", | |
| "pageElement":"id(\"bkmrktable\")", | |
| "nextLink":"//a[starts-with(text(),\"\\u6B21\\u3078\")]", | |
| "wedata.net.id":47943 | |
| }, | |
| { | |
| "url":"^http://www\\.mangapanda\\.com/(?:\\d+-\\d+-\\d+/|[^/]+/\\d+(?:$|/))", | |
| "pageElement":"id('imgholder')/a[img]", | |
| "nextLink":"id('imgholder')/a[img]", | |
| "wedata.net.id":61034 | |
| }, | |
| { | |
| "url":"^http://booklog\\.jp/(release|booklive|galapagos|opds|review|pickup)", | |
| "pageElement":"//table[contains(@class,\"tableType2\")]//tr[not(./th)][not(./td[@class=\"listSortArea\"])]", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":77513 | |
| }, | |
| { | |
| "url":"^http://(soccer|baseball|sports)\\.yahoo\\.co\\.jp/.+/(news|photos?)", | |
| "insertBefore":"ニュースと写真を分離", | |
| "pageElement":"//*[@class='pickup_list pb20p' or @class='pb20p' or @class='clearfix mb15p' or @class='glanceArticleBox']", | |
| "nextLink":"//a[.='次へ']", | |
| "wedata.net.id":76254 | |
| }, | |
| { | |
| "url":"^http://newsonjapan\\.com/cgi-bin/(news|japandirectory)/search\\.cgi", | |
| "pageElement":"//div[@class='news-item'] | //td[child::b[contains(.,'Search Results')]]/p[1]/following-sibling::*[following-sibling::hr[last()]]", | |
| "nextLink":"//a[contains(.,'[>>]')]", | |
| "wedata.net.id":64965 | |
| }, | |
| { | |
| "url":"^http://www\\.atmarkit\\.co\\.jp/fwcr/design/(tag|teamwork).+\\.html", | |
| "pageElement":"id(\"centercol\")/font[@size=\"2\"]/following-sibling::*[following-sibling::table[.//td[@align=\"center\"]/b]]|//p[@class=\"bakLink\"]/preceding-sibling::*|//div[@class=\"headset\"]/*[not(./p[@class=\"bakLink\"])]", | |
| "nextLink":"id(\"centercol\")//a[img[contains(@src,\"next\")]]", | |
| "wedata.net.id":77250 | |
| }, | |
| { | |
| "url":"^http://erecipe\\.woman\\.excite\\.co\\.jp/(?:search|food|category)/", | |
| "pageElement":"id('searchRslt')/ul/li", | |
| "nextLink":"//div[contains(concat(\" \",@class,\" \"),\" pager \")]/span[@class=\"active\"]/following-sibling::a", | |
| "wedata.net.id":55760 | |
| }, | |
| { | |
| "url":"^http://girlish-s\\.haru\\.gs/[\\w\\.\\-]+/(?:[\\w\\-]+/(?:\\w+/)?)?", | |
| "pageElement":"//*[self::table[not(parent::td)] or (not(ancestor::table) and (self::a[img and not(parent::div)] or self::div[a[img]] or self::div[preceding-sibling::table]))]", | |
| "nextLink":"//a[(ancestor::table and (child::img[contains(@src, \"tugi\")] or contains(., \"\u6b21\"))) or (not(ancestor::table) and child::img[@alt!=\"WCR\u6295\u7968\" and @alt!=\"FC2 Analyzer\"])]", | |
| "wedata.net.id":40821 | |
| }, | |
| { | |
| "url":"^http://www\\.aoky\\.net/articles/why_poignant_guide_to_ruby/chapter", | |
| "pageElement":"id(\"container\")/*", | |
| "nextLink":"id(\"banner\")//a[.=\"\u6b21\u3078\"][@href!=\"index.html\"]", | |
| "wedata.net.id":33014 | |
| }, | |
| { | |
| "url":"^https?://(?:rikunabi-next\\.yahoo\\.co\\.jp|next\\.rikunabi\\.com)/", | |
| "pageElement":"//ol[@class='n_list_950']/li", | |
| "nextLink":"//div[@class='spr_next']/a", | |
| "wedata.net.id":30642 | |
| }, | |
| { | |
| "url":"^https?://.*(?:bgr|(?:b|h)ollywoodlife|deadline|footwearnews)\\.com/", | |
| "pageElement":"//*[contains(@id,'content')]//*[(contains(@id,'post-') and not(//div[@class='hl-post'])) or self::div[@class='hl-post']/div[contains(@id,'post-')]]", | |
| "nextLink":"//nav/a[contains(@class,'prev')]|//div[@class='alignright' or contains(@class,'next-link btn-next')]/a", | |
| "wedata.net.id":74923 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?iranyellowpages\\.net/en/indexes/index_companies/", | |
| "pageElement":"//table[starts-with(@style,'background-repeat')]", | |
| "nextLink":"//a[img/@src='../../Images/Next.jpg']", | |
| "wedata.net.id":35737 | |
| }, | |
| { | |
| "url":"^https://(?:www\\.iy-net|iy-net\\.7netshopping)\\.jp/(?:iyns/)?nspc/", | |
| "pageElement":"//div[starts-with(@class,'mod-shoppingContents_body')]/*|//ul[starts-with(@class,'box goodslist')]/*", | |
| "nextLink":"//span/a[contains(.,'次へ')]", | |
| "wedata.net.id":55748 | |
| }, | |
| { | |
| "url":"^https://wirelesswire\\.jp/([^/]+|.*/photo-report)/[0-9\\-]+\\.html", | |
| "pageElement":"//div[@class='body']", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":39768 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?firefly\\.pate\\.jp/(?:prologue|page_\\d+)\\.htm", | |
| "pageElement":"//div/table", | |
| "nextLink":"//p/descendant::a[.=\"Next \u2192\"]", | |
| "wedata.net.id":55164 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?8bitpeoples\\.com/categories/digital-discography", | |
| "pageElement":"//div[@class='product']", | |
| "nextLink":"//span[@class='next']/a", | |
| "wedata.net.id":2024 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?asahi\\.co\\.jp/php/precure_suite/bbs/view\\.php", | |
| "pageElement":"//div[@class=\"bbs_message\"]", | |
| "nextLink":"//span[@class=\"nx\"]/a", | |
| "wedata.net.id":45778 | |
| }, | |
| { | |
| "url":"^http://www\\.dreamvs\\.jp/pc/index\\.php\\?.*toid=PC_SEARCH_RESULT", | |
| "pageElement":"//div[@class='search_result_item_wrap']/*", | |
| "nextLink":"//a[img/@alt='右へ進む']", | |
| "wedata.net.id":50193 | |
| }, | |
| { | |
| "url":"^https?://bh\\.pid\\.nhk\\.or\\.jp/pidh07/ProgramSearch/Search\\.do", | |
| "pageElement":"//table[@class='result']/tbody/tr[td]", | |
| "nextLink":"//span[@class=\"pageListActive\"]/following-sibling::a[1]", | |
| "wedata.net.id":40597 | |
| }, | |
| { | |
| "url":"^http://www\\.kakuyasu\\.co\\.jp/ec/disp/CSfDispListPage_001\\.jsp", | |
| "pageElement":"//form[@name=\"listForm\"]/div", | |
| "nextLink":"id(\"contentsContainer\")/div[@class=\"pagerArea\"]//a[@class=\"next\"]", | |
| "wedata.net.id":31778 | |
| }, | |
| { | |
| "url":"^http://(?:(?:a|www\\.bran)dsoftheworld\\.com|creativebits\\.org)/", | |
| "pageElement":"//ul[@class='inline-list' or @class='logos']/li|//div[starts-with(@id,'blog-') or @class='comment ']|//tr[@class='odd' or @class='even']", | |
| "nextLink":"//li[starts-with(@class,'pager-next')]/a", | |
| "wedata.net.id":32567 | |
| }, | |
| { | |
| "url":"^https?://www2\\.toshokan\\.city\\.shizuoka\\.jp/winj/opac/.+\\.do", | |
| "pageElement":"//table[@class=\"table_list\"]//tr[not(th)]", | |
| "nextLink":"//div[@class=\"page_shift\"]/a[last()][not(@href=\"/winj/opac/search-list.do?page=1\")]", | |
| "wedata.net.id":74971 | |
| }, | |
| { | |
| "url":"^http://www\\.diy-education\\.com/cgi-bin/database2/database\\.cgi", | |
| "pageElement":"id(\"mainmain\")", | |
| "nextLink":"id(\"mainfooter\")/p/a[contains(text(), \"次の\")]", | |
| "wedata.net.id":64769 | |
| }, | |
| { | |
| "url":"^http://www\\.(?:new-akiba\\.com|ura-akiba\\.jp)/(?:archive|new)s/", | |
| "pageElement":"//div[@class=\"kiji-column-main\"][not(//div[@class=\"pager\"])]/div[p]/preceding-sibling::*|//div[@class=\"pager\"]/preceding-sibling::*|//h1[@class=\"kiji-column-title\"]", | |
| "nextLink":"//div[@class=\"kiji-column-main\"]/div[./p]//a[last()][not(@href=\"/\" or contains(@href,\".html\"))]|//div[@class=\"pager\"]/a[1][not(@href=\"http://www.ura-akiba.jp/\")]", | |
| "wedata.net.id":31116 | |
| }, | |
| { | |
| "url":"^http://www\\.dosv\\.jp/(?:feature|sp_page|wdc|other|intel)/[^/]+/", | |
| "pageElement":"(id(\"contentsHead\")/*[not(self::h2 or self::address)] | id(\"article\")/*) | id(\"contents_body\") | //img[contains(@src, \"title.jpg\")]/../../following-sibling::tr[following::img[contains(@src, \"try_next.gif\") or contains(@src, \"try_back.gif\")] and not(descendant::td/@class='subtitle')]", | |
| "nextLink":"id(\"next\")/a | //img[contains(@src, \"try_next.gif\")]/../preceding-sibling::td/a[last()] | //a[text()=\"Next\"]", | |
| "wedata.net.id":1790 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?(:?tokyotosho\\.(?:info|se)|tokyo-tosho\\.net)/", | |
| "pageElement":"id(\"main\")/form/table[@class=\"listing\"]", | |
| "nextLink":"id(\"main\")/form/table//tr/td[@class=\"nav\"]/a[contains(text(),\"Next\")]", | |
| "wedata.net.id":549 | |
| }, | |
| { | |
| "url":"^http://www2d\\.biglobe\\.ne\\.jp/~ks_wca/(?:comic|com\\d+b\\.htm)", | |
| "pageElement":"//p[@align=\"center\"]/img", | |
| "nextLink":"//img[contains(@src, \"next\")]/parent::a", | |
| "wedata.net.id":32853 | |
| }, | |
| { | |
| "url":"^http://www\\.kadokawa\\.co\\.jp/company/release/(?!detail\\.html)", | |
| "pageElement":"//table[@class=\"news\"]", | |
| "nextLink":"//a[@class=\"pagelink\" and contains(text(), \"次へ\")]", | |
| "wedata.net.id":65635 | |
| }, | |
| { | |
| "url":"^http://baseball\\.yahoo\\.co\\.jp/npb/(?:headlines|photos|video)/", | |
| "pageElement":"id(\"NpbNewsSearch\")/ul|id(\"art_list\")/div|//div[@class=\"NpbPhotoList\"]|id(\"mv_list\")/table", | |
| "nextLink":"//div[@class=\"NpbPagingRight yjMS\"]/a[last()]|id(\"10_navi\")//ul/li[last()]/a", | |
| "wedata.net.id":53859 | |
| }, | |
| { | |
| "url":"^http://www\\.pref\\.hiroshima\\.lg\\.jp/soshiki/list1-\\d+\\.html", | |
| "pageElement":"id(\"main_body\")/div[@class=\"list_ccc\"]", | |
| "nextLink":"id(\"main_body\")/div[last()]/a[preceding-sibling::node()[1][(normalize-space(self::text()) != \"] [\") and (contains(normalize-space(self::text()), \" [\"))]]", | |
| "wedata.net.id":64183 | |
| }, | |
| { | |
| "url":"^http://lists\\.w3\\.org/Archives/Public/(?:[^/]+/){2}[^.]+\\.html", | |
| "pageElement":"//div[@class=\"mail\"]", | |
| "nextLink":"id(\"navbar\")/ul/li/a[.=\"Next in thread\"]", | |
| "wedata.net.id":36860 | |
| }, | |
| { | |
| "url":"^http://www\\.oricon\\.co\\.jp/(news|special)/tag/id/event_report/", | |
| "pageElement":"//article[contains(@class,\"card\")]", | |
| "nextLink":"//a[@class=\"pager-next\"]", | |
| "wedata.net.id":56673 | |
| }, | |
| { | |
| "url":"^http://(?:extensions|templates)(\\.services)?\\.openoffice\\.org/", | |
| "pageElement":"//div[@class='row'][div/@class='col-xs-6']", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":31233 | |
| }, | |
| { | |
| "url":"^http://jpn\\.nec\\.com/profile/mitatv/discover/\\d+(?:_sequel)?/", | |
| "pageElement":"//div[@class='boxSection-01'][ul/@class='newsList-02 size-02']/*", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":74255 | |
| }, | |
| { | |
| "url":"^http://(?:[^.]+\\.)?camelcamelcamel\\.com/(?:search|products)\\?", | |
| "pageElement":"id('products_list')//tr", | |
| "nextLink":"//div[@class='pagination ']/span[@class='current']/following-sibling::a[1]", | |
| "wedata.net.id":53519 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?mccomix\\.com/(?:members/)?gallery2/main\\.php", | |
| "insertBefore":"//div[@class=\"block-core-PeerList\"]", | |
| "pageElement":"id(\"gsImageView\")", | |
| "nextLink":"//a[@class=\"next\"]", | |
| "wedata.net.id":32251 | |
| }, | |
| { | |
| "url":"^http://rating\\d*\\.auctions\\.yahoo\\.co\\.jp/jp/show/rating\\?", | |
| "pageElement":"//table[@bgcolor=\"#ffffff\"][.//b[text()=\"\u8a55\u4fa1\uff1a\"]]", | |
| "nextLink":"//small/b/a[text()=\"\u6b21\u306e25\u4ef6\"]", | |
| "wedata.net.id":26637 | |
| }, | |
| { | |
| "url":"^http://www\\.vstone\\.co\\.jp/robotshop/index\\.php\\?main_page=", | |
| "pageElement":"//table[@class='tabTable']/tbody/tr[td]", | |
| "nextLink":"//strong[@class='current']/following-sibling::a[1]", | |
| "wedata.net.id":76334 | |
| }, | |
| { | |
| "url":"^http://book\\.geocities\\.jp/nashigoren_745ren/\\w+/p\\d+\\.html", | |
| "pageElement":"//p/a[img]", | |
| "nextLink":"//p/a[img][@href!=\"http://book.geocities.jp/nashigoren_745ren/\"]", | |
| "wedata.net.id":55228 | |
| }, | |
| { | |
| "url":"^http://(www\\.)?sunhayato\\.co\\.jp/material2/index\\.php/search", | |
| "pageElement":"//div[@class='item_box_wrapper']/*", | |
| "nextLink":"//a[@class='next page-numbers']", | |
| "wedata.net.id":26659 | |
| }, | |
| { | |
| "url":"^http://carview\\.yahoo\\.co\\.jp/article/(?:testdrive|market)/.+", | |
| "pageElement":"//div[@class='sub-sentence']/*", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":27186 | |
| }, | |
| { | |
| "url":"^https://www\\.mydocomo\\.com/dcm/dfw/i_mode/myd/storage/addrlist", | |
| "pageElement":"//table[@class=\"BgColor06\" and @summary=\"layout\"]", | |
| "nextLink":"//a[@class=\"color-0035c9u\" and contains(text(),\"次の\")]", | |
| "wedata.net.id":2637 | |
| }, | |
| { | |
| "url":"^http://www\\.books-sanseido\\.co\\.jp/reserve/bookSearch\\.do\\?", | |
| "pageElement":"//div[@class=\"booklist\"]", | |
| "nextLink":"//a[@class=\"page-link\"][text()=\"\u6b21\u30da\u30fc\u30b8\u3078\"]", | |
| "wedata.net.id":25653 | |
| }, | |
| { | |
| "url":"^http://(www\\.)?(?:geekologie|iwatchstuff|thesuperficial)\\.com/", | |
| "pageElement":"//div[@class='entry']", | |
| "nextLink":"//a[li/@class='page-navigation-left']", | |
| "wedata.net.id":32557 | |
| }, | |
| { | |
| "url":"^http://javstar\\.co/|^http://www\\.ja35.net/|^http://ja35\\.net/", | |
| "pageElement":"//div[@id=\"channels\"]", | |
| "nextLink":"//a[(text()=\"»»\")]", | |
| "wedata.net.id":80963 | |
| }, | |
| { | |
| "url":"^http://www\\.de-hon\\.ne\\.jp/digital/bin/qfind_detail\\.asp\\?", | |
| "pageElement":"//div[@class=\"result\"]", | |
| "nextLink":"//span[@class=\"now_show_result\" and ../@class=\"all_shows_right\"]/following-sibling::a[1]", | |
| "wedata.net.id":64829 | |
| }, | |
| { | |
| "url":"^https?://www\\.tumblr\\.com/(?:dashboard|blog|tagged|like|show)", | |
| "pageElement":"id(\"posts\")/li[div[starts-with(@id, \"post_\")]]", | |
| "nextLink":"id(\"next_page_link\")", | |
| "wedata.net.id":54652 | |
| }, | |
| { | |
| "url":"^https?://(?:[^.]+\\.)?google\\.(?:[^.]{2,3}\\.)?[^./]{2,3}/news", | |
| "pageElement":"//div[@class='topic']/div", | |
| "nextLink":"//a[div/@id='end-next']", | |
| "wedata.net.id":479 | |
| }, | |
| { | |
| "url":"^http://business\\.nikkeibp\\.co\\.jp/((new)?ar?ti?cle?|readers)", | |
| "pageElement":"id('articleBody') | id('leaf-main')//div[@class='story'] | //section[@class='articleBlock']//li | id('reader')/div//li", | |
| "nextLink":"id('naviBottom')//a[@class='tonext'][last()][not(following-sibling::a)] | //div[@class='next_p' or @class='nextPage']/a | id('pagenation')//a[@class='next']", | |
| "wedata.net.id":514 | |
| }, | |
| { | |
| "url":"^http://www\\.javlibrary\\.com/(ja|en|en|tw)/(?!videocomments).*", | |
| "pageElement":"//div[@id='rightcolumn']", | |
| "nextLink":"//a[@class='page next']", | |
| "wedata.net.id":80829 | |
| }, | |
| { | |
| "url":"^http://lets\\.postgresql\\.jp/documents/tutorial/postgresql-abc", | |
| "pageElement":"//ul[@class='pagenation']/preceding-sibling::*", | |
| "nextLink":"//li[span/@class='current']/following-sibling::li[1]/a", | |
| "wedata.net.id":64978 | |
| }, | |
| { | |
| "url":"^http://otn\\.oracle\\.co\\.jp/otn_pl/otn_tool2/search_forum_exe", | |
| "pageElement":"//p[table[@class=\"msg_table\"]] | //table[@class=\"msg_table\" and not(parent::p)]", | |
| "nextLink":"//p[@align=\"right\"]/b/font[@color=\"red\"]/../following-sibling::b[1]/a", | |
| "wedata.net.id":2494 | |
| }, | |
| { | |
| "url":"^https://booklive\\.jp/(?:search|ranking|select|product/series)/", | |
| "pageElement":"//ul[@class='search_item_list' or contains(concat(' ', @class, ' '), ' search_item_thumb_list ') or @id='search_item_text_list']/li", | |
| "nextLink":"//li[@class='page_nav_next']/a | //li[@class='product_series_pagecr']/following-sibling::li/a", | |
| "wedata.net.id":77740 | |
| }, | |
| { | |
| "url":"^http://news\\.mynavi\\.jp/series/(cupid|toshiko|town|majomojo)/", | |
| "pageElement":"//div[contains(@class,\"center\")][not(.//img[contains(@src,\"images/003.jpg\")])]|//div[contains(@class,\"center\")][not(.//img[contains(@src,\"images/003.jpg\")])]/following-sibling::*[self::p or self::h3]|//div[contains(@class,\"center\")][not(.//img[contains(@src,\"images/003.jpg\")])]/preceding-sibling::*[self::p or self::h3]|//p[@class=\"lyt-hdg-03-03\"]", | |
| "nextLink":"//link[@rel=\"next\"]", | |
| "wedata.net.id":80855 | |
| }, | |
| { | |
| "url":"^http://[^.]+\\.librarything\\.[^.]{2,3}/catalog_bottom\\.php\\?", | |
| "pageElement":"id('lt_catalog_list')/tbody/tr", | |
| "nextLink":"//a[contains(@class,'pageShuttleButton')][not(contains(@href,'offset=0'))]", | |
| "wedata.net.id":499 | |
| }, | |
| { | |
| "url":"^http://(?:video\\.)?mixi\\.jp/search_(?:review|video|item)\\.pl", | |
| "pageElement":"//li[@class='listItem clearfix']", | |
| "nextLink":"//a[.='次を表示']", | |
| "wedata.net.id":2536 | |
| }, | |
| { | |
| "url":"^http://www\\.comicbox\\.co\\.jp/jr/comics/index\\.cgi\\?.*cmd=s", | |
| "pageElement":"//table[@class='list_data']//tr[td]", | |
| "nextLink":"//a[.='次のページ']", | |
| "wedata.net.id":65376 | |
| }, | |
| { | |
| "url":"^https?://.+?(for(um|o)|/viewtopic\\.php\\?|/t/\\d+/|4allmobile)", | |
| "pageElement":"id('pagecontent')//table[@class='tablebg']//tr[starts-with(@class,'row') or td/@class='spacer']|//table[@class='forumline']//tr[td[contains(@class,'ow') and not(input/@name='post' or textarea/@id='quickreply_textarea')]]|(id('page-body page-body-inner reading-pane')|//div[@class='page-content'])/div[contains(@class,'post')]|//table[@class='border-bleu-jos']|id('punviewtopic')//div[contains(@class,'blockpost')]", | |
| "nextLink":"(//*[@class='gensmall']/b/*[self::b or self::strong]|//table/tbody/tr/td[@class='nav'][last()]/b[last()]|(//div[@class='pagination']/span|//p[@class='pagelink conl'])/strong|//ul[@class='pn']/li[span/@class='curr'])/following-sibling::a[1]|(//link[not(@title='View next topic')]|//a)[.='Next' or @rel='next']", | |
| "wedata.net.id":27331 | |
| }, | |
| { | |
| "url":"^http://detail\\.chiebukuro\\.yahoo\\.co\\.jp/qa/question_detail", | |
| "pageElement":"id(\"main\")//div[@class=\"othrAns clrfx\" or @class=\"mdLtlAdd\"]", | |
| "nextLink":"//li/a[@class=\"aft\"]", | |
| "wedata.net.id":1943 | |
| }, | |
| { | |
| "url":"^http://nibiirogarasu\\.web\\.fc2\\.com/nevaeva/\\w+/\\w+\\.html", | |
| "insertBefore":"rn", | |
| "pageElement":"//div[@class='cont2']/h5[1]/preceding-sibling::node()", | |
| "nextLink":"//div[@class='cont2']/p[1]/a[last()]", | |
| "wedata.net.id":39519 | |
| }, | |
| { | |
| "url":"^http://(?:ejje|shuwa|thesaurus|www)\\.weblio\\.jp/content_find/", | |
| "pageElement":"id(\"cntFdWrp\")/div[@class=\"cntFdHead\" or @class=\"cntFdBody\"]", | |
| "nextLink":"id(\"cntFdWrp\")/div[@class=\"cntFdPaging\"]/a[contains(text(), \"\u6b21\u306e\")]", | |
| "wedata.net.id":30466 | |
| }, | |
| { | |
| "url":"^https?://www\\.amusement-center\\.com/project/emusic/news\\.php", | |
| "pageElement":"//div[@class='egginfo_item']", | |
| "nextLink":"//div[@class='itemprev']/a", | |
| "wedata.net.id":1126 | |
| }, | |
| { | |
| "url":"^http://(?:(?:ja|de|es)\\.)?favstar\\.fm/users/\\w+/status/\\d+$", | |
| "pageElement":"//div[@class=\"tweetWithStats\"]", | |
| "nextLink":"//div[@class=\"tweetBy\"]/a[strong]", | |
| "wedata.net.id":41244 | |
| }, | |
| { | |
| "url":"^http://news\\.mixi\\.jp/list_(?:quote_diar|news_categor)y\\.pl", | |
| "pageElement":"id('bodyMainArea')/div[@class='relationDiary']/div[@class='quoteDiaryArea01']|id('bodyMainArea')/div[@class='newsList']/div[@class='contents']//tr", | |
| "nextLink":"//div[@class='pageNavigation01']/div[@class='pageList02']/ul/li/a[.='次を表示']", | |
| "wedata.net.id":2538 | |
| }, | |
| { | |
| "url":"^http://(www\\.)?tsutaya\\.(?:co|tsite)\\.jp/(?:artist|search)/", | |
| "pageElement":"//ul[@class='c_thumb_list_row c_js_equal_height']/li|//div[@class='tolListRvwWrapC']", | |
| "nextLink":"//li[@class='c_pager_num-next' or @class='tolLRWBliEnd']/a", | |
| "wedata.net.id":725 | |
| }, | |
| { | |
| "url":"^http://shonenelement\\.oboroduki\\.com/\\w+(?:top|\\d+)\\.html", | |
| "pageElement":"//table", | |
| "nextLink":"//table//td/a[@href=\"index.html\"]/preceding-sibling::a", | |
| "wedata.net.id":40780 | |
| }, | |
| { | |
| "url":"^http://fuji3aproject\\.blog86\\.fc2\\.com/blog-entry-.+\\.html", | |
| "pageElement":"//div[@class=\"entry_bottom\"]/*", | |
| "nextLink":"//p[@class=\"page_navi\"]/child::a[last()]", | |
| "wedata.net.id":52527 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?kinozal\\.tv(?:/\\?page=\\d+|/browse\\.php)?", | |
| "pageElement":"//div[@class='tp1_border']/* | //table[@class='t_peer w100p']/tbody/tr[@class='bg']", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":77619 | |
| }, | |
| { | |
| "url":"^http://www\\.chunichi\\.co\\.jp/chuspo/article/dragons/draban/", | |
| "pageElement":"//div[@class='data-area02']/*[not(@class='News-headarea')]", | |
| "nextLink":"id(\"Contents\")//div[@class=\"list-day\"]/ul/li[./a[contains(text(),concat(\"月\",number(substring-before(substring-after(//p[@class=\"data\"],\"月\"),\"日\")),\"日\"))]]/following-sibling::li[1]/a", | |
| "wedata.net.id":62561 | |
| }, | |
| { | |
| "url":"^https://scholar\\.google\\.(?:[^.]{2,3}\\.)?[^./]{2,3}/scholar", | |
| "pageElement":"//div[@class='gs_r']", | |
| "nextLink":"//b[@class='gs_nma']/following-sibling::a[1]", | |
| "wedata.net.id":480 | |
| }, | |
| { | |
| "url":"^https://www\\.goodreads\\.com/(?:book/show|search|review/list)", | |
| "pageElement":"//div[contains(@class,'elementListBrown')] | (//table[@class='tableList']|id('books'))//tr[td]", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":31627 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?456\\.com/pages/s(?:ubcategory|earch)\\.php4", | |
| "pageElement":"id(\"wrapper\")//form[@action='/cart/cart.php4']/ancestor::table[1]|id('wrapper')//form[@action='/cart/cart.php4']/ancestor::table[1]/following-sibling::br[1]", | |
| "nextLink":"//a[contains(concat(' ', @class, ' '), ' SubCategory ') or contains(concat(' ', @class, ' '), ' Search ')][.='次のページ >>']", | |
| "wedata.net.id":55465 | |
| }, | |
| { | |
| "url":"^https?://www\\.google\\.(?:[^.]{2,3}\\.)?[^./]{2,3}/bookmarks/", | |
| "pageElement":"//div[@id=\"search\"]/div[span[starts-with(@id, \"bkmk_view_\")]]", | |
| "nextLink":"//a[contains(concat(\" \", normalize-space(@class), \" \"), \" kd-button \")][img[contains(@src, \"right.png\")]]", | |
| "wedata.net.id":2049 | |
| }, | |
| { | |
| "url":"^http://www\\.abilityfuse\\.co\\.jp/ask/student/search/db\\.cgi", | |
| "pageElement":"//table[@class='searchlist-table']//tr[td]", | |
| "nextLink":"//div[@class='target2']/div/a[u[contains(.,'次の')]]", | |
| "wedata.net.id":64770 | |
| }, | |
| { | |
| "url":"^http://[^.]+\\.google\\.(?:[^.]{2,3}\\.)?[^./]{2,3}/codesearch", | |
| "insertBefore":"id(\"navbar\")", | |
| "pageElement":"//*[self::div[@class=\"h\"] or self::pre[@class=\"j\"] or self::div[@class=\"f\"]]", | |
| "nextLink":"(id(\"navbar\")//td[@class=\"b\"]/a)[last()]", | |
| "wedata.net.id":477 | |
| }, | |
| { | |
| "url":"^http://www\\.imdb\\.com/name/[^/]+/(?:mediaindex|videogallery)", | |
| "pageElement":"id('media_index_thumbnail_grid')/*[self::a]|//div[@class='search-results']/ol/li", | |
| "nextLink":"(id('right')|//span[@class='pagination'])/a[last()]", | |
| "wedata.net.id":30845 | |
| }, | |
| { | |
| "url":"^http://monster-girl\\.homelinux\\.net/(?:upload\\.cgi|index|$)", | |
| "pageElement":"id(\"list\")", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":30920 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?syosetu\\.net/pc/.*(?:main|novel|book)\\.php", | |
| "pageElement":"//*[@class=\"panel-body\"]", | |
| "nextLink":"//nav/div[contains(@class,\"btn-group-justified\")]/div[3]/a", | |
| "wedata.net.id":26494 | |
| }, | |
| { | |
| "url":"^https://djangosnippets\\.org/(?:languages|popular|tags|users)/", | |
| "pageElement":"id('content')/table/tbody/tr", | |
| "nextLink":"//p[@class='pagination']/a[contains(.,'>')]", | |
| "wedata.net.id":33428 | |
| }, | |
| { | |
| "url":"^http://(?:[^./]+\\.)?photobucket\\.com/(?:albums|home|images)/", | |
| "pageElement":"id('search-thumbnail-list')/*", | |
| "nextLink":"id('nextButton')", | |
| "wedata.net.id":35354 | |
| }, | |
| { | |
| "url":"^http://numbers2007\\.blog123\\.fc2\\.com/(page-[\\d]+\\.html)?", | |
| "pageElement":"id('main_block')/*[h2/@class='entry_title']", | |
| "nextLink":"//a[.='次のページへ']", | |
| "wedata.net.id":76313 | |
| }, | |
| { | |
| "url":"^http://www\\.itokin\\.net/(?:products|outlet)/eb_ppt002\\.php", | |
| "pageElement":"id('item_list')/*", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":65444 | |
| }, | |
| { | |
| "url":"^https?://www\\.amazon(?:\\.[^./]{2,3}){1,2}/gp/offer-listing/", | |
| "pageElement":"//div[@class=\"a-section a-spacing-double-large\"]/*[not(@class=\"a-row a-spacing-mini\")]", | |
| "nextLink":"//li[@class=\"a-last\"]/a", | |
| "wedata.net.id":36310 | |
| }, | |
| { | |
| "url":"^http://yotsuba\\.saiin\\.net/~heart-of-haa/[a-z]+[0-9]+\\.htm", | |
| "pageElement":"//p|//center", | |
| "nextLink":"//a[text()=\"\u6b21\u3078\"]", | |
| "wedata.net.id":2620 | |
| }, | |
| { | |
| "url":"^https?://(secured\\.|www\\.)weltrade\\.[^/]+/community/forum/", | |
| "pageElement":"//div[@class='wt-border-box-inner-block']/*", | |
| "nextLink":"//span[contains(@class,'modern-page-current')]/following-sibling::a[1]", | |
| "wedata.net.id":76977 | |
| }, | |
| { | |
| "url":"^http://(hon|shukan)\\.bunshun\\.jp/(category/column|articles)", | |
| "pageElement":"//div[@class='article-list']//li|id('editor')/*[not(@class='next-info' or @class='author-name')]", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":62655 | |
| }, | |
| { | |
| "url":"^http://www\\.bs-garden\\.com/feature/.+(?:pre(?!sent)|pickup)", | |
| "pageElement":"//img[contains(@src, \"pre\") and (200 < @width)]", | |
| "nextLink":"//a[img[contains(@src, \"next\")]]", | |
| "wedata.net.id":72764 | |
| }, | |
| { | |
| "url":"^http://www\\.kerneldesign\\.info/wiki/index\\.php\\?2005_6_23", | |
| "pageElement":"id(\"body\")/*[not(span/a/text()='次へ進む>>') and not(br/@class='spacer' and br[2]/@class='spacer')]", | |
| "nextLink":"id(\"body\")//a[contains(text(),\"次へ進む\")]", | |
| "wedata.net.id":72782 | |
| }, | |
| { | |
| "url":"^http://blog\\.(?:xn--er-573a1isbf1441e2hs87j|埋もれる抱き枕er)\\.jp/", | |
| "pageElement":"id(\"content\")/div[contains(concat(\" \", normalize-space(@class), \" \"), \" entries \")]", | |
| "nextLink":"//a[contains(concat(\" \", normalize-space(@class), \" \"), \" nextpostslink \")]", | |
| "wedata.net.id":57792 | |
| }, | |
| { | |
| "url":"^http://www\\.telegraph\\.co\\.uk/[^/]+/[^/]*picturegalleries/", | |
| "pageElement":"//div[@class='twoThirds gutter gutterUnder']", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":29577 | |
| }, | |
| { | |
| "url":"^http://akiba-pc\\.watch\\.impress\\.co\\.jp/hotline/.+/image/", | |
| "pageElement":"//table[@align='center']//tr[last()]", | |
| "nextLink":"//td[@align='right']/small/a", | |
| "wedata.net.id":29970 | |
| }, | |
| { | |
| "url":"^https?://(www\\.)?clip-studio\\.com/clip_site/material/search", | |
| "pageElement":"id(\"thumb_table\")", | |
| "nextLink":"//div[@class=\"navi\"]/a[@title=\"\u6b21\u3078\"]", | |
| "wedata.net.id":49324 | |
| }, | |
| { | |
| "url":"^https?://www\\.sociomedia\\.co\\.jp/category/uidesignpatterns", | |
| "pageElement":"//ul[@class=\"excerptedpostblock\"]", | |
| "nextLink":"//li[@class=\"active_page\"]/following-sibling::li[1]/a", | |
| "wedata.net.id":28175 | |
| }, | |
| { | |
| "url":"^http://(?:jbpress|karadastyle|wedge)\\.ismedia\\.jp/articles/", | |
| "pageElement":"id('mp-ie')[.//@class='clearfix']/preceding-sibling::*|(//div[@class='common-pg' or contains(@class,'mp-ie')]|id('mp-ie multipage pagenation')[not(.//@class='clearfix')])/preceding-sibling::node()[not(@class='article-signage' or @class='breadcrumb' or @id='signage' or @id='bread_list')]/*", | |
| "nextLink":"//a[../@class='next_p']", | |
| "wedata.net.id":25843 | |
| }, | |
| { | |
| "url":"^http://www3\\.mofa\\.go\\.jp/mofaj/gaiko/treaty/search2\\.php", | |
| "pageElement":"id('data')/table", | |
| "nextLink":"//a[contains(.,'次へ')]", | |
| "wedata.net.id":64683 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?uniforme(\\.co)?\\.jp/(shopbrand|headline)/", | |
| "pageElement":"id('item_all')/ul/li|id('post')/*", | |
| "nextLink":"//li[@class='active']/following-sibling::li[1]/a|//a[@rel='next']", | |
| "wedata.net.id":31685 | |
| }, | |
| { | |
| "url":"http://www.myfreecams.com/php/user_chat_images.php.+category.+", | |
| "pageElement":"//table/tbody/tr/td/div[contains(@style,\"float:left\")] | //table[@class=\"container_table\"]/tbody/tr/td/div[@class=\"content\"]/table", | |
| "nextLink":"//div[@class=\"content\"]/span[1]/a[(text()=\">\")]", | |
| "wedata.net.id":77778 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?j-e-a-n-s\\.net/(?:(?:item|page|searche)s)/", | |
| "pageElement":"id('brandmenu')/table/tbody/tr[not(td/text()) or td/span/@class='item_det'][not(.//@alt='uparrow')]|id(\"ranking\")/tbody/tr[not(.//@alt='uparrow')]|id(\"news_cont\")/div[@class=\"jnews_w\"]/*", | |
| "nextLink":"id('list_page')/span[@class='now']/following-sibling::a[1]|id('next')", | |
| "wedata.net.id":38155 | |
| }, | |
| { | |
| "url":"^http://(?:www|forum)\\.pcdvd\\.com\\.tw/forumdisplay\\.php\\?", | |
| "pageElement":"//td[@width=\"100%\"][@valign=\"top\"]/table[@class=\"tborder\"]/tbody/tr[td[@class=\"alt1Active\"]]", | |
| "nextLink":"//div[@class=\"pagenav\"]//a[text()=\"下一頁\"]", | |
| "wedata.net.id":2384 | |
| }, | |
| { | |
| "url":"^http://blog\\.goo\\.ne\\.jp/victory-sakuragawamegu(?:$|[/?#])", | |
| "pageElement":"(//div[@class='entry-bottom-pn']|id('mod-prev-next')[not(//div[@class='entry-bottom-pn'])])/preceding-sibling::div[@class='mod-entry-set']", | |
| "nextLink":"//li[@class='mod-pre-nex-prev']/a", | |
| "wedata.net.id":31777 | |
| }, | |
| { | |
| "url":"^https://www\\.iy-net\\.jp/nsmarket/recipe/recipelist\\.do\\?", | |
| "pageElement":"//ul[starts-with(@class,'recipelist')]/li", | |
| "nextLink":"//li[contains(@class,'nextitem')]/a", | |
| "wedata.net.id":25927 | |
| }, | |
| { | |
| "url":"^http://movapic\\.com/[^/]+(?:/(?:with_follow|p(?:ubl)?ic)s)?", | |
| "pageElement":"id(\"content\")/*", | |
| "nextLink":"id(\"paginate\")/div/a[@class=\"nextLink\" or contains(.,\"前の月\")]", | |
| "wedata.net.id":39039 | |
| }, | |
| { | |
| "url":"^http://www\\.geocities\\.jp/momokita00/\\d+/\\d+_\\d+\\.html", | |
| "pageElement":"//img", | |
| "nextLink":"//a[contains(.,'次へ')]", | |
| "wedata.net.id":39978 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?futabasha\\.co\\.jp/booksdb/book/listview/", | |
| "pageElement":"id(\"pulldown\")/following-sibling::*[not(@class=\"pagination\")]", | |
| "nextLink":"id(\"default_right_area\")/p[@class=\"pagination\"]/strong/following-sibling::a[1]", | |
| "wedata.net.id":27217 | |
| }, | |
| { | |
| "url":"^http://typhoon\\.yahoo\\.co\\.jp/weather/jp/earthquake/list/", | |
| "pageElement":"id(\"eqhist\")//tr[1]/following-sibling::tr", | |
| "nextLink":"id(\"pageNextback\")//strong/following-sibling::a[1]", | |
| "wedata.net.id":54479 | |
| }, | |
| { | |
| "url":"^http://www\\.thinkpad-club\\.net/modules/d3forum/index\\.php", | |
| "pageElement":"//div[@class='d3f_wrap']/*|id('centercolumn')/div/table/tbody", | |
| "nextLink":"//a[u='»' or .='投稿の新しいものから']", | |
| "wedata.net.id":27201 | |
| }, | |
| { | |
| "url":"^http://search\\.www\\.infoseek\\.co\\.jp/(Blog|Web|Image)\\?", | |
| "pageElement":"//ul[@class='os-result' or @class='image-result']/li", | |
| "nextLink":"//a[@class='next-sc-page-serp']", | |
| "wedata.net.id":30255 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?shouga-bu\\.com/recipe/search/result\\.php", | |
| "pageElement":"//div[contains(@class,\"setWrap\")]", | |
| "nextLink":"//ul[contains(@class,\"pageNav\")]/li[@class=\"next\"]/a", | |
| "wedata.net.id":26714 | |
| }, | |
| { | |
| "url":"^http://oilgas-info\\.jogmec\\.go\\.jp/(?:sougou|report)\\.pl", | |
| "pageElement":"//tr[td/@class='mainText']", | |
| "nextLink":"//a[@class='ssText'][contains(.,'次へ')]", | |
| "wedata.net.id":65910 | |
| }, | |
| { | |
| "url":"^http://www\\.oricon\\.co\\.jp/music/interview/\\d+/\\w+\\d+/", | |
| "pageElement":"id(\"container\")/*[@class=\"articleArea\" or @class=\"pgArea\"]|//div[@class='pgBtnArea']", | |
| "nextLink":"//ul[@class='pageNum']/li[a/@class='select']/following-sibling::li/a[1]|//a[img/@src='http://contents.oricon.co.jp/music/images/btn_next.gif' and img/@alt='>>']", | |
| "wedata.net.id":56331 | |
| }, | |
| { | |
| "url":"^http://csselite\\.com/category/(?:resources|showcase)(?:$|/)", | |
| "pageElement":"//div[@class='oneBox' or @class='commentBox']", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":437 | |
| }, | |
| { | |
| "url":"^http://suzunonejh\\.blog15\\.fc2\\.com/(page-[\\d]+\\.html)?", | |
| "pageElement":"//*[@class=\"left\"]/*[self::h3 or @class='body']", | |
| "nextLink":"//a[contains(.,'次のページ')]", | |
| "wedata.net.id":76315 | |
| }, | |
| { | |
| "url":"^http://homepage3\\.nifty\\.com/shinkukan/seminar/semi\\d{2}/", | |
| "pageElement":"//div[@class=\"linkt\"]/following-sibling::*[following-sibling::div[@class=\"linkb\"]]", | |
| "nextLink":"//a[.=\"[NEXT]\"]", | |
| "wedata.net.id":60488 | |
| }, | |
| { | |
| "url":"^http://www\\.retrojunk\\.com/([^/]+-index|content|community)", | |
| "pageElement":"//div[contains(@class,'Unit')]|//tr[@class='row']", | |
| "nextLink":"//ul[@class=\"pagination\"]/li[./span[@class=\"current\"]]/following-sibling::li[1]/a", | |
| "wedata.net.id":77019 | |
| }, | |
| { | |
| "url":"^http://bn\\.merumo\\.ne\\.jp/backno/(?:latest|body)View\\.do", | |
| "pageElement":"//div[@class=\"bn_content\"]/div[@class=\"bn_head\" or @class=\"bn_content_text\"]", | |
| "nextLink":"//div[@class=\"bn_content\"]/ul[@class=\"bn_navi\"]/li[@class=\"prev\"]/a", | |
| "wedata.net.id":33235 | |
| }, | |
| { | |
| "url":"^https?://www\\.google\\.(?:[^.]{2,3}\\.)?[^./]{2,3}/history/", | |
| "pageElement":"//table[@class=\"res\"]", | |
| "nextLink":"//td[@class=\"bl\"][last()-1]/a|//div[@class=\"nn\"]/parent::a", | |
| "wedata.net.id":473 | |
| }, | |
| { | |
| "url":"^http://www\\.nijibox3\\.com/magical/futaba/[^/]+/viewa\\.php", | |
| "pageElement":"//div/table/tbody/tr", | |
| "nextLink":"//div/a[contains(.,'次へ')]", | |
| "wedata.net.id":30839 | |
| }, | |
| { | |
| "url":"^http://(www|archive)\\.oreilly.com/(?:pub/a/)?[^/]+/archive/", | |
| "pageElement":"(//div[@style='float:left;width:760px;padding-right:10px;']|id('article-content'))/*[not(@id='page-break')][(not(@class='secondary') and not(@class='breadcrumb')) or self::em/table]|//em[table]/*[not(@id='page-break')]", | |
| "nextLink":"id('page-break')//p[@class='secondary']/b/following-sibling::a[1]", | |
| "wedata.net.id":519 | |
| }, | |
| { | |
| "url":"^http://www\\.famitsu\\.com/news/\\d+/images/\\d+/\\w+\\.html", | |
| "pageElement":"id(\"articleBox\")/node()[self::div[@align=\"center\"] or not(self::*)]", | |
| "nextLink":"id(\"articleBox\")/div[@align=\"center\"]/a[img]", | |
| "wedata.net.id":45567 | |
| }, | |
| { | |
| "url":"^http://www\\.coremagazine\\.co\\.jp/drap_comics/(no|drap-bn)", | |
| "pageElement":"//td[@background=\"waku/w4.gif\"]/following-sibling::td[1][not(@class)]/*[not(self::hr)]", | |
| "nextLink":"//td[@valign='top'][./img[contains(@src,'waku')]]/following-sibling::td[1]/a| //td[@class='bntextb'][a]/text()[contains(.,'年')]/following-sibling::a", | |
| "wedata.net.id":65452 | |
| }, | |
| { | |
| "url":"^http://www\\.the-journal\\.jp/contents/[^/]+/\\d{4}/\\d\\d/", | |
| "pageElement":"id(\"alpha-inner\")", | |
| "nextLink":"id(\"alpha-inner\")/p[@class=\"content-nav\"]/a[1][starts-with(.,\"\u00ab\")]", | |
| "wedata.net.id":31137 | |
| }, | |
| { | |
| "url":"^http://www\\.urbanoutfitters\\.com/urban/catalog/.+\\.jsp.+", | |
| "pageElement":"//li[@class='product']", | |
| "nextLink":"//a[@class='icon icon-RightArrow']", | |
| "wedata.net.id":29514 | |
| }, | |
| { | |
| "url":"^http://honto\\.jp/(?:(?:netstore|ebook)/search|ranking/gr/)", | |
| "pageElement":"//div[@class='stBoxLine01']", | |
| "nextLink":"//li[@class='stNext']/a", | |
| "wedata.net.id":61375 | |
| }, | |
| { | |
| "url":"^http://www\\.entamenext\\.com/news/detail(?:/\\d+)?/id=\\d+", | |
| "pageElement":"id('mainContBody')/div[@class='contents']/div[contains(@class,'editArea')]", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":77776 | |
| }, | |
| { | |
| "url":"^http://www\\.milovana\\.com/webteases/showtease\\.php\\?id=", | |
| "insertBefore":"id('fs')", | |
| "pageElement":"id('csl')", | |
| "nextLink":"id('continue')", | |
| "wedata.net.id":76291 | |
| }, | |
| { | |
| "url":"^http://[^.]+\\.sblo\\.jp/(?:archives|category)/[^.]+\\.html", | |
| "pageElement":"id(\"content\")/div[@class=\"blog\"]", | |
| "nextLink":"//div[not(preceding-sibling::div[@class=\"navi\"])][not(following-sibling::div[@class=\"navi\"]/a[text()=\">>\"])]/a[text()=\"<<\"]|//div[preceding-sibling::div[@class=\"navi\"]][@class=\"navi\"]/a[text()=\">>\"]", | |
| "wedata.net.id":2168 | |
| }, | |
| { | |
| "url":"^http://www\\.amusement-center\\.com/project/egg/index\\.cgi", | |
| "pageElement":"//div[@class='article clearfix']", | |
| "nextLink":"//span[@class='page_guide']/strong[number()>0]/following-sibling::a[1]", | |
| "wedata.net.id":56691 | |
| }, | |
| { | |
| "url":"^http://(cdn\\.)?enjoykorea\\.web\\.fc2\\.com/\\w+\\d+\\.htm", | |
| "pageElement":"//p[@align='center'][1]", | |
| "nextLink":"//a[.='NEXT']", | |
| "wedata.net.id":72711 | |
| }, | |
| { | |
| "url":"^http://bizacademy\\.nikkei\\.co\\.jp/[\\w/]+/article\\.aspx", | |
| "pageElement":"//div[@class=\"edu-article-text\"]/*", | |
| "nextLink":"//span[@class=\"edu-pagenavi-arrow\"][not(following-sibling::*)]/a", | |
| "wedata.net.id":55743 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?matome-plus\\.(com|net|sakura\\.ne\\.jp)/", | |
| "pageElement":"id(\"content\")//div[@class=\"sitebox\" or @class=\"div-x\" or @class=\"div-y\"]", | |
| "nextLink":"id(\"content\")//div[@class=\"pagination\"]/ul/li[last()]/a[not(@class=\"currentpage\")]", | |
| "wedata.net.id":30464 | |
| }, | |
| { | |
| "url":"^http://w+\\d+\\.oekakibbs\\.com/bbs/[^/?#]+/oekakibbs\\.cgi", | |
| "pageElement":"//center[number(translate(.//font/.,\"[]\",\"\"))>0]/following-sibling::*[following-sibling::center[number(translate(.//font/.,\"[]\",\"\"))>0]]", | |
| "nextLink":"//a[starts-with(., \"[次の\")]", | |
| "wedata.net.id":2103 | |
| }, | |
| { | |
| "url":"^http://archive\\.tewi\\.us/tegaki/s(?:how|ortby)tags?\\.php", | |
| "pageElement":"//div[@class='thumbnail']", | |
| "nextLink":"//a[.='Next >']", | |
| "wedata.net.id":55487 | |
| }, | |
| { | |
| "url":"^http://(?:home|sale)\\.adpark\\.co\\.jp/ws/rhSrch.action\\?", | |
| "pageElement":"//tr[td/@class='photos' or @class='result_item']", | |
| "nextLink":"//li[@class='nowPageNum']/following-sibling::li[1]/a", | |
| "wedata.net.id":29459 | |
| }, | |
| { | |
| "url":"^http://tv\\.so-net\\.ne\\.jp/(?:chart/[\\w/]+?\\.action|m/)", | |
| "pageElement":"id(\"chartColumn\")", | |
| "nextLink":"//a[descendant::img[@src=\"/tv/digital/img/btn/btn_arrow_j.gif\"]]", | |
| "wedata.net.id":1751 | |
| }, | |
| { | |
| "url":"^http://www5c\\.biglobe\\.ne\\.jp/~nyu/COMIC/(?!comic\\.htm)", | |
| "pageElement":"//*[a[img] or table]", | |
| "nextLink":"//a[img and not(contains(@href, \"#\"))]", | |
| "wedata.net.id":37920 | |
| }, | |
| { | |
| "url":"^http://news\\.mynavi\\.jp/series/(nekoaruaru|homo|hormone)/", | |
| "pageElement":"//div[contains(@class,\"center\")]|//div[contains(@class,\"center\")]/following-sibling::*[following-sibling::div[@class=\"left\"]]|//div[contains(@class,\"center\")]/preceding-sibling::p|//div[@class=\"left\"]/following-sibling::p[1][not(./b)]|//p[@class=\"lyt-hdg-03-03\"]", | |
| "nextLink":"//link[@rel=\"next\"]", | |
| "wedata.net.id":80859 | |
| }, | |
| { | |
| "url":"^http://www\\.behindthevoiceactors\\.com/(news|top-listings)", | |
| "pageElement":"id('content_wide_left')/div/div[@class='latest_news_main' or @class='divider'][./following-sibling::div[not(@class='clear')]][//meta[contains(@content,'http://www.behindthevoiceactors.com/news/')]/@property='og:url']|id('top_listings')//tr[td]", | |
| "nextLink":"//a[@title='Read Older News']|//li[span/@class='jPag-current']/following-sibling::li[1]/a", | |
| "wedata.net.id":77716 | |
| }, | |
| { | |
| "url":"^http://(?:www|forum)\\.pcdvd\\.com\\.tw/showthread\\.php\\?", | |
| "pageElement":"id(\"posts\") | id(\"posts\")/following-sibling::div[@align=\"center\"][position() < last()]", | |
| "nextLink":"//div[@class=\"pagenav\"]//a[text()=\"\u4e0b\u4e00\u9801\"]", | |
| "wedata.net.id":2385 | |
| }, | |
| { | |
| "url":"^http://book(\\.akahoshitakuya|meter)\\.com/home\\?main=book", | |
| "pageElement":"id('main_left')//div[contains(concat(' ',@class,' '),' book ')]", | |
| "nextLink":"//span[@class='now_page']/following-sibling::span/a", | |
| "wedata.net.id":77745 | |
| }, | |
| { | |
| "url":"^http://norestfor\\.himegimi\\.jp/archive/\\d+i?-\\d+\\.html", | |
| "pageElement":"//table//img[(parent::a or parent::td) and starts-with(@src, \"pages/\")]", | |
| "nextLink":"//a[img[starts-with(@src, \"pages/\")]]", | |
| "wedata.net.id":39514 | |
| }, | |
| { | |
| "url":"^http://www\\.project-magi\\.com/news/(?!news_detail\\.html)", | |
| "pageElement":"//div[@id='news_detail_box']", | |
| "nextLink":"id('news_next')/p/a", | |
| "wedata.net.id":72542 | |
| }, | |
| { | |
| "url":"^http://(?:aurasoul\\.)?mb2\\.jp/_[^/]+/[0-9]+_[0-9]+\\.html", | |
| "pageElement":"id(\"RES\")/div", | |
| "nextLink":"//span[@class=\"ryaku\"]/a[text()=\"↓次のページを読む\"]", | |
| "wedata.net.id":25724 | |
| }, | |
| { | |
| "url":"^http://enokix\\.web\\.fc2\\.com/comic/(?:neko/)?\\w+\\.html", | |
| "pageElement":"//center/*[descendant-or-self::img[@galleryimg=\"false\"]]", | |
| "nextLink":"//center/a", | |
| "wedata.net.id":37491 | |
| }, | |
| { | |
| "url":"^http://sai-zen-sen\\.jp/(editors//?blog|special/takegarou)/", | |
| "pageElement":"id('page-content-body')/*[not(self::footer or @class='related-works')]", | |
| "nextLink":"//li[@class='page-flipper_next even' or @id='commentGroupNav_next']/a", | |
| "wedata.net.id":37055 | |
| }, | |
| { | |
| "url":"^http://yuuumm55\\.web\\.fc2\\.com/(?!dorasya-)[\\w-]+\\.htm", | |
| "pageElement":"//center/descendant::*[self::a[img] or self::img[not(parent::a)]][descendant-or-self::img[translate(@align, \"CENRT\", \"cenrt\")=\"center\" or translate(@align, \"DEILM\", \"deilm\")=\"middle\"]]", | |
| "nextLink":"//center/descendant::*[self::a[text()=\"BACK\"] or self::img[not(following-sibling::a[text()=\"BACK\"])]]/following-sibling::a[@href!=\"dorasya-.htm\"]", | |
| "wedata.net.id":40760 | |
| }, | |
| { | |
| "url":"^http://[^.]+\\.asablo\\.jp/blog/(?:$|cat|\\?offset=|\\d{4})", | |
| "pageElement":"id('main')/div[starts-with(@class,'msg')]", | |
| "nextLink":"//a[@class='navi-prev'][//div/@class='comment-form']|//a[@class='navi-next'][not(//div/@class='comment-form')]", | |
| "wedata.net.id":1563 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?contextfreeart\\.org/gallery/search\\.php", | |
| "pageElement":"id('CFAcontent')/*[not(@class='clearleft')]", | |
| "nextLink":"id('CFAcontent')/div[@class='clearleft']/a[2]", | |
| "wedata.net.id":54598 | |
| }, | |
| { | |
| "url":"^http://dengekionline\\.com/sp/nekomimi/\\d{2}/\\d{2}\\.html", | |
| "pageElement":"//div[starts-with(@id,'main')]", | |
| "nextLink":"id('pagelink')/li/a[img[contains(@src,'next')]]", | |
| "wedata.net.id":61212 | |
| }, | |
| { | |
| "url":"^http://www\\.flickr\\.com/photos/[^/]+/favorites(?:[/?#]|$)", | |
| "insertBefore":"//div[@class=\"Pages\"]", | |
| "pageElement":"id(\"faves\")", | |
| "nextLink":"id(\"paginator-module\")/descendant::a[contains(concat(\" \", @class, \" \"), \" Next \")]", | |
| "wedata.net.id":457 | |
| }, | |
| { | |
| "url":"^https://partner\\.afl\\.rakuten\\.co\\.jp/af/a_report\\.cgi", | |
| "pageElement":"//table[.//font[.=\"発生日時\"]]", | |
| "nextLink":"//a[contains(@href,\"/a_report.cgi?\")][starts-with(.,\"次の\")]", | |
| "wedata.net.id":30236 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?benchmark\\.pl/testy_i_recenzje/.+\\.html", | |
| "pageElement":"//div[@class='m_zwykly']/div[@class='body']/*[not(@class='k_ster')]", | |
| "nextLink":"//span[@class='next']/parent::a[1]", | |
| "wedata.net.id":53916 | |
| }, | |
| { | |
| "url":"^http://b-prince\\.com/wp-content/search\\.php(?!\\?BSisbn=)", | |
| "pageElement":"id('table_box')//tr[td/a]", | |
| "nextLink":"//span[@class='active'][1]/following-sibling::span/a", | |
| "wedata.net.id":65634 | |
| }, | |
| { | |
| "url":"^http://www\\.imdb\\.com/(?:.+/.+/mediaindex|media|features)", | |
| "pageElement":"//div[contains(@class,'thumb_list')]/a|id('photo-container')", | |
| "nextLink":"//a[(@class='prevnext' and .='Next »') or @class='media-single-next btn secondary small']", | |
| "wedata.net.id":74670 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?enterbrain\\.co\\.jp/fb/pc/03novels/[01]3", | |
| "pageElement":"id(\"novelcontents\")/*[self::table[@class=\"pager\"] or self::div[@class=\"newpager\"]]|//div[@align=\"center\" or contains(@style,\"text-align: center;\") or contains(@style,\"text-align:center;\")]/*[self::table[@class=\"pager\"] or self::div[@class=\"newpager\"]]/following-sibling::*[following-sibling::table[@class=\"pager\"] or following-sibling::div[@class=\"newpager\"]]", | |
| "nextLink":"//div[@align=\"center\" or contains(@style,\"text-align: center;\")]/table/tbody/tr/td[last()]/a|//div[@class=\"newpager\"]/div[@class=\"new_next\"]/a", | |
| "wedata.net.id":34229 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?todayhumor\\.co\\.kr/board/list\\.php\\?", | |
| "pageElement":"//table[@class='table_list']//tr[position()>1]", | |
| "nextLink":"//a[contains(img/@src,'nextpage.gif')]", | |
| "wedata.net.id":54172 | |
| }, | |
| { | |
| "url":"^http://(www\\.)?boardgamegeek\\.com/(browser|forum|thread)", | |
| "pageElement":"//table[@class='collection_table' or @class='forum_table'][last()]/tbody/tr[td]|//div[@class='js-rollable article ']", | |
| "nextLink":"//a[b='Next »']", | |
| "wedata.net.id":939 | |
| }, | |
| { | |
| "url":"^http://www\\.citeulike\\.org/(user/.+/tag/.+/page/|search)", | |
| "pageElement":"id('list_table')/tbody/tr", | |
| "nextLink":"//span[@align=\"left\"]/b[last()][not(./following-sibling::a)]/a", | |
| "wedata.net.id":612 | |
| }, | |
| { | |
| "url":"^http://(?:houbunsha\\.co\\.jp|111\\.89\\.128\\.15)/search/", | |
| "pageElement":"//div[contains(concat(\" \", @class, \" \"), \" entrycontainer \")]", | |
| "nextLink":"id(\"topposition\")/li/span/parent::li/following-sibling::li[1]/a", | |
| "wedata.net.id":63180 | |
| }, | |
| { | |
| "url":"^https?://developer\\.mozilla\\.org/[^/]+/docs/(?:all|tag/)", | |
| "pageElement":"//ul[@class='document-list']/li", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":64699 | |
| }, | |
| { | |
| "url":"^http://hiroba\\.dqx\\.jp/(sc/forum/pretop|news|category)/.", | |
| "pageElement":"//div[@class='forum_threadlist']/*|//div[@class='newsList']//tr", | |
| "nextLink":"//a[@class='pagerNext']", | |
| "wedata.net.id":70108 | |
| }, | |
| { | |
| "url":"^https?://msdn\\.microsoft\\.com/ja-jp/windowsazure/claudia", | |
| "pageElement":"//div[ol]/node()[self::div[p] or self::table or not(*)]", | |
| "nextLink":"//div[ol]/ol[1]/li[img]/following-sibling::li/a", | |
| "wedata.net.id":53856 | |
| }, | |
| { | |
| "url":"^http://www\\.lispworks\\.com/documentation/HyperSpec/Body/", | |
| "pageElement":"//hr[1]/following-sibling::node()[./following::hr]", | |
| "nextLink":"//a[@rel=\"NEXT\"]", | |
| "wedata.net.id":32838 | |
| }, | |
| { | |
| "url":"^http://crocro\\.com/write/manga_javascript/wiki\\.cgi\\?p=", | |
| "pageElement":"//div[contains(concat(\" \", @class, \" \"), \" body \")]", | |
| "nextLink":"//a[@class=\"wikipage\" and contains(., //div[@class=\"mainIn\"]/h1)]/parent::li/following-sibling::li[1]/a", | |
| "wedata.net.id":33025 | |
| }, | |
| { | |
| "url":"https?://www\\.(fananimes|mangago)\\.(?:com|me)/read-manga/", | |
| "pageElement":"id(\"pic_container\")", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":76332 | |
| }, | |
| { | |
| "url":"^http://www\\.hayakawa-online\\.co\\.jp/(?:shop/)?shopbrand", | |
| "pageElement":"//ul[@class='innerList']/li", | |
| "nextLink":"//li[@class='active']/following-sibling::li/a", | |
| "wedata.net.id":32517 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?mantan-web\\.jp/(\\d+/\\d+/\\d+/|search)", | |
| "pageElement":"//ul[@class='allarchive__list']/li|id('popin_content_main')//li", | |
| "nextLink":"//a[@class='prev' or @rel='next']", | |
| "wedata.net.id":33337 | |
| }, | |
| { | |
| "url":"^http://bookshelf\\.chara-info\\.net/(?:category/|tag/|\\?)", | |
| "pageElement":"//ul[contains(concat(\" \", @class, \" \"), \" relation-list \")]", | |
| "nextLink":"//span[@class=\"current\"]/following-sibling::a", | |
| "wedata.net.id":75023 | |
| }, | |
| { | |
| "url":"^http://www\\.geocities\\.jp/asumithi/(?:[^/]+/)?\\w+\\.htm", | |
| "pageElement":"//*[self::p or self::center or self::hr]", | |
| "nextLink":"//a[text()=\"\u6b21\u3078\"]", | |
| "wedata.net.id":31337 | |
| }, | |
| { | |
| "url":"^http://www\\.nhk\\.or\\.jp/strl/aboutstrl/evolution-of-tv/", | |
| "pageElement":"id('contents')/*", | |
| "nextLink":"id('gnavi')/ul/li[a[contains(@style, 'no-repeat')]]/following-sibling::li[1]/a", | |
| "wedata.net.id":65168 | |
| }, | |
| { | |
| "url":"^http://www\\.vim\\.org/scripts/script_search_results\\.php", | |
| "pageElement":"//tr[@class='tableheader']/following-sibling::tr[td/@class]", | |
| "nextLink":"//a[.='next']", | |
| "wedata.net.id":560 | |
| }, | |
| { | |
| "url":"^http://www2\\.jrt\\.co\\.jp/cgi-bin3/ikuniweb/tomozo\\.cgi", | |
| "pageElement":"id(\"logs\")", | |
| "nextLink":"id(\"navi\")/ul/li[last()]/a", | |
| "wedata.net.id":27400 | |
| }, | |
| { | |
| "url":"^http://himemiko\\.kir\\.jp/honbun/\\d{2}/\\d-\\d{3}\\.html", | |
| "pageElement":"id('contents')/h1/following-sibling::p[following-sibling::p/strong]", | |
| "nextLink":"//p/strong/a[last()][not(@href='mokuzi-01.html')]", | |
| "wedata.net.id":76474 | |
| }, | |
| { | |
| "url":"^http://www\\.tsadult\\.net/Megalopolis/\\?path=\\d+/\\d+.+", | |
| "pageElement":"id(\"contentBody\")", | |
| "nextLink":"//li[contains(@class, 'last')]/a", | |
| "wedata.net.id":79983 | |
| }, | |
| { | |
| "url":"^http://www\\.liar\\.co\\.jp/\\w{3,4}_(?:web)?novel\\d{3,4}", | |
| "pageElement":"//table[.//td[@class=\"unnamed1\"]]|//p[@class=\"bacetext\"][img]|//p[img][following-sibling::table]|//img[following-sibling::table or following-sibling::embed]|//img[following-sibling::embed]/following-sibling::node()[following-sibling::span[@class=\"bacetext\"]]|//span[@class=\"bacetext\" and preceding-sibling::embed]", | |
| "nextLink":"(//table/tbody/tr/td|//*[@class=\"bacetext\"]/descendant-or-self::span)//text()[normalize-space(.)=\"\u25b3\"]/following-sibling::text()[number(translate(normalize-space(.),\"\uff11\uff12\uff13\uff14\uff15\uff16\uff17\uff18\uff19\",\"123456789\"))>0]/following::a[normalize-space(text())]|(//table/tbody/tr/td|//*[@class=\"bacetext\"]/descendant-or-self::span)//text()[normalize-space(.)=\"\u25bd\"]/following-sibling::a[normalize-space(text())]", | |
| "wedata.net.id":54753 | |
| }, | |
| { | |
| "url":"^http://news\\.nifty\\.com/cs/catalog/news_pssearch/search/", | |
| "pageElement":"//ul[@class=\"newsList\"]/li", | |
| "nextLink":"//p[@class=\"more\"]/a", | |
| "wedata.net.id":29434 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?japandesign\\.ne\\.jp/HTM/(?:REPORT|NY)/", | |
| "pageElement":"//td[@class='fo12_33']/../../.. | //table[@class='fo10x12_33' or @class='fo10_gr'] | //br[@class='fo12']/following-sibling::node()[following::a[.='← b_a_c_k ' or .='n_e_x_t →']][.//img] | id('linkalert-box')/following-sibling::table", | |
| "nextLink":"//a[.='N E X T' or .='n_e_x_t →'] | //font[.='N E X T']/..", | |
| "wedata.net.id":1837 | |
| }, | |
| { | |
| "url":"^http://news\\.livedoor\\.com/(?:article|category)/images?/", | |
| "pageElement":"//ul[@class='imageList']/li", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":29656 | |
| }, | |
| { | |
| "url":"^http://\\w+\\.blogmura\\.com/tb_entry\\d+(?:_\\d+)?\\.html", | |
| "pageElement":"//div[@class='widget-wapper arrival1 ttl2Orange']//div[@class='widget-cont-inner']/table//tr[.//img]", | |
| "nextLink":"//div[@class='page-tab']/ul/li[last()]/a", | |
| "wedata.net.id":31672 | |
| }, | |
| { | |
| "url":"^http:\\/\\/sz-magazin.sueddeutsche.de\\/.*\\/bildergalerie", | |
| "pageElement":"//div[@id='bilder-galerie-content']", | |
| "nextLink":"//a[@class='next-arrow']", | |
| "wedata.net.id":77244 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?publickey1?\\.jp/blog/14/252100web25web", | |
| "pageElement":"id(\"maincol\")/p[contains(text(),\"本記事ではそのダイジェストを\")]/following-sibling::node()[./following-sibling::node()[ following::div[@class=\"recommends\"]]]", | |
| "nextLink":"id(\"maincol\")/p[last()]/a[./following-sibling::em[contains(.,\"前の記事\")]]", | |
| "wedata.net.id":74684 | |
| }, | |
| { | |
| "url":"^http://www\\.symphonic-net\\.com/futaba/miku/[^.]+\\.htm$", | |
| "pageElement":"//form[@name='post2']/hr[last()]/preceding-sibling::node()[preceding-sibling::div]", | |
| "nextLink":"//td/b/following-sibling::a", | |
| "wedata.net.id":34586 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?questionablecontent\\.net/view\\.php\\?", | |
| "pageElement":"id(\"strip\")/parent::a", | |
| "nextLink":"id(\"strip\")/parent::a", | |
| "wedata.net.id":56920 | |
| }, | |
| { | |
| "url":"^http://www\\.kokuyo-st\\.co\\.jp/search/sp_search_1\\.php", | |
| "pageElement":"id('products')/*", | |
| "nextLink":"//li[@class='nxtb']/a", | |
| "wedata.net.id":64780 | |
| }, | |
| { | |
| "url":"^http://blog\\.textt\\.net/(?:\\w+|\\?page=\\d+&user=\\w+)", | |
| "pageElement":"id(\"entries\")", | |
| "nextLink":"//a[@class=\"next_page\"]", | |
| "wedata.net.id":55256 | |
| }, | |
| { | |
| "url":"^http://www\\.bookshop-ps\\.com/bsp/bsp_(?!detail|magcode)", | |
| "pageElement":"//table[@class='list']//tr[td/@class='c2']", | |
| "nextLink":"//a[contains(.,'次へ>>>')]", | |
| "wedata.net.id":64117 | |
| }, | |
| { | |
| "url":"^http://style\\.fm/as/05_column/(?:\\w+/)?\\w+\\d+\\.shtml", | |
| "pageElement":"(//td[@valign=\"top\" and @align=\"left\"]/table|id(\"path_block\"))/following-sibling::*", | |
| "nextLink":"//*[@class=\"text2\"]/a[contains(.,\"\u7d9a\")]|//p[@class=\"next\"]/a[img]|//a[img[contains(@src,\"next\")] or contains(@onmouseover,\"next\")]", | |
| "wedata.net.id":55624 | |
| }, | |
| { | |
| "url":"^http://dl21\\.web\\.fc2\\.com/comic/\\w+/[^/]*\\d+\\.html", | |
| "pageElement":"//p[@align=\"center\"]/font", | |
| "nextLink":"//a[.='next']", | |
| "wedata.net.id":39977 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?futabasha\\.co\\.jp/tachiyomi/smp\\.php", | |
| "pageElement":"//div[@role=\"main\"]/img", | |
| "nextLink":"//div[@class=\"ui-block-b\"]/a[starts-with(.,\"NEXT\")]", | |
| "wedata.net.id":80694 | |
| }, | |
| { | |
| "url":"^http://community\\.hardsextube\\.com/(?:[^/]+/)+?page/\\d", | |
| "pageElement":"id(\"left\")/div[contains(concat(\" \", @class, \" \"), \" profboxcontent \")]//table[1]", | |
| "nextLink":"id(\"pagesel\")/span[@style]/following-sibling::span[1]/a", | |
| "wedata.net.id":54296 | |
| }, | |
| { | |
| "url":"^http://portal\\.nifty\\.com/(?:cs/link/backnumber/|kiji/)", | |
| "pageElement":"id(\"mainContentsInner\")/div[@class=\"sns_list_box\"]/preceding-sibling::*[not(self::h1)]|//td[@align=\"center\"][./b]/ancestor::td[@align=\"center\"][1]/table/tbody/tr", | |
| "nextLink":"(id('mainContents')//td[@align='center']|id('links'))/b/following-sibling::a[1]", | |
| "wedata.net.id":55341 | |
| }, | |
| { | |
| "url":"^http://www\\.bigcosmic\\.com/board/s/board\\.cgi\\?id=spo", | |
| "pageElement":"//a[b='次へ' or b='戻る'][1]/preceding-sibling::br[1]/preceding-sibling::node()[preceding::table[@width='430' and not(@bordercolor)]]", | |
| "nextLink":"//a[b=\"次へ\"]", | |
| "wedata.net.id":65373 | |
| }, | |
| { | |
| "url":"^https?://(?:d|[^.]+\\.g)\\.hatena\\.ne\\.jp/[^/]+/archive", | |
| "pageElement":"//ul[@class='archives']/*", | |
| "nextLink":"id('hatena-archive')/div[@class='calendar']/a[contains(., '古い')]", | |
| "wedata.net.id":708 | |
| }, | |
| { | |
| "url":"^http://www\\.atsoho\\.com/(?:job|soho)info/index/type-\\d", | |
| "pageElement":"//table[@class='table']//tr[not(td/@bgcolor='#99CCFF')]", | |
| "nextLink":"id('center_contents')/div[contains(concat(' ', @class, ' '), ' table_sentence ')][last()]/text()[contains(.,'1') or contains(.,'2') or contains(.,'3') or contains(.,'4') or contains(.,'5') or contains(.,'6') or contains(.,'7') or contains(.,'8') or contains(.,'9')]/following-sibling::a[1]", | |
| "wedata.net.id":41272 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?publickey1?\\.jp/[^/]+/\\d+/\\w+\\.html", | |
| "pageElement":"id(\"maincol\")/node()[./following-sibling::node()[following::div[@class=\"recommends\"]]]", | |
| "nextLink":"id(\"maincol\")/p[last()]/em[contains(.,\"前の記事\")]/following-sibling::a", | |
| "wedata.net.id":31136 | |
| }, | |
| { | |
| "url":"^http://www\\.1101\\.com/pl/\\d{6}kesennuma2?/index\\.html", | |
| "pageElement":"//div[@class='autopagerize_page_element']/*", | |
| "nextLink":"//a[img[contains(@src,'navi_back')]]", | |
| "wedata.net.id":76278 | |
| }, | |
| { | |
| "url":"^http://ameblo\\.jp/jazzgodfather/entry-11505986459\\.html", | |
| "pageElement":"//article", | |
| "nextLink":"//a[@class=\"pagingPrev\"]", | |
| "wedata.net.id":76469 | |
| }, | |
| { | |
| "url":"^http://(tv2ch\\.com|2chan\\.tv|img\\.uploda\\.info)/jlab-", | |
| "pageElement":"//div[@class=\"ImageElements\"]", | |
| "nextLink":"//div[@class=\"ImagePageLink\"][last()]/ul/li/following-sibling::a[1]", | |
| "wedata.net.id":56308 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?todaysppc\\.com/mbzine/bbs/bbs\\.php\\?", | |
| "pageElement":"//table[form][not(@background)]//tr[./td[@class=\"list_header2\"]]/following-sibling::tr", | |
| "nextLink":"//a[contains(img/@src,'btn_next.gif')]", | |
| "wedata.net.id":54171 | |
| }, | |
| { | |
| "url":"^http://www\\.washingtonpost\\.com/wp-dyn/content/article/", | |
| "pageElement":"id(\"article_body\")", | |
| "nextLink":"id(\"pagination_bottom\")//a[text()=\"Next\"]", | |
| "wedata.net.id":2670 | |
| }, | |
| { | |
| "url":"^http://www\\.honda\\.co\\.jp/WGP/spcontents2011/analysis/", | |
| "pageElement":"id(\"miyagi_foot\")/preceding-sibling::*", | |
| "nextLink":"//p[@class=\"genba_arrow2\"]/a", | |
| "wedata.net.id":54503 | |
| }, | |
| { | |
| "url":"^https?://(?:www\\.|tech\\.)?ascii\\.jp/elem/(?:[^/]+/){4}", | |
| "pageElement":"(id(\"articleHead\")|id(\"contdefault\")/*[@class=\"newauthor\" or (self::h1 and not(following-sibling::p/@class=\"newauthor\" or preceding-sibling::p/@class=\"newauthor\"))])/following-sibling::*[following-sibling::div[contains(\" pager pages pgbottom pagerComic \",concat(\" \",@class,\" \"))]]|id(\"articleText\")", | |
| "nextLink":"//a[@class=\"next\" or parent::span[@class=\"next\"] or contains(text(), \"(続きはこちら)\") or img/@src=\"/img/bt_comicnex.gif\"]|//span[@class=\"next\" and last()]/a[contains(text(),\"次へ\")]|//ul[@class=\"pager\"]/li/a[contains(text(), \"次へ\")]", | |
| "wedata.net.id":424 | |
| }, | |
| { | |
| "url":"https://www\\\\.netbk\\\\.co\\\\.jp/wpl/NBGate/i020201CT.+", | |
| "pageElement":"//div[@class=\"tableb02\"]/table/tbody", | |
| "nextLink":"//a[contains(text(), \"→\")]", | |
| "wedata.net.id":62431 | |
| }, | |
| { | |
| "url":"http://blog\\.livedoor\\.jp/tangomin/archives/\\d+\\.html", | |
| "pageElement":"//div[@class=\"article is-border\"]", | |
| "nextLink":"//li[@class=\"next both\"]/a", | |
| "wedata.net.id":77279 | |
| }, | |
| { | |
| "url":"^http://photo\\.net/gallery/photocritique/filter(?:$|\\?)", | |
| "pageElement":"id(\"searchbar\")/following-sibling::div[@class=\"trp_photo\" or @class=\"rowsep\"]", | |
| "nextLink":"//a[@class=\"nxt\"]", | |
| "wedata.net.id":32472 | |
| }, | |
| { | |
| "url":"^https?://appengine\\.google\\.com/datastore/explorer\\?.", | |
| "pageElement":"id(\"ae-datastore-explorer-entities\")", | |
| "nextLink":"id(\"ae-datastore-explorer\")//a[@class=\"ae-paginate-next\"]", | |
| "wedata.net.id":474 | |
| }, | |
| { | |
| "url":"^http://oshibori-art\\.com/dobby/\\d+/episode-\\w+\\.html", | |
| "pageElement":"id(\"page\")/*", | |
| "nextLink":"//table//a", | |
| "wedata.net.id":39992 | |
| }, | |
| { | |
| "url":"^http://www\\.(wallpapers|photos|ip(hone|ad))-room\\.com/", | |
| "pageElement":"//div[@class='wallpapers-listing' or @class='photos-listing']/div[starts-with(@class,'thumb') or starts-with(@class,'clear')]", | |
| "nextLink":"//div[@class='next-page-button ']/a", | |
| "wedata.net.id":31907 | |
| }, | |
| { | |
| "url":"^http://www\\.nikkeibp\\.co\\.jp/(article/)?hco/(search)?", | |
| "pageElement":"//div[@class='article-body styled']/*|id('searchResult')//li", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":52534 | |
| }, | |
| { | |
| "url":"^http://www\\.mediafactory\\.co\\.jp/bunkoj/library/index", | |
| "pageElement":"//div[@class='kanren_shoseki_waku']", | |
| "nextLink":"id('paging')/text()[number(normalize-space(.)) > 0]/following-sibling::a", | |
| "wedata.net.id":65415 | |
| }, | |
| { | |
| "url":"^http://www\\.1101\\.com/pl/kesennuma_suzume/index\\.html", | |
| "pageElement":"//img[@alt=\"前へ\"]/ancestor::table[1]/preceding-sibling::table", | |
| "nextLink":"//a[img/@alt='前へ']", | |
| "wedata.net.id":76280 | |
| }, | |
| { | |
| "url":"^http://www\\.sengoku\\.co\\.jp/mod/sgk_cart/search\\.php", | |
| "pageElement":"//div[starts-with(@id,\"list_box\")]", | |
| "nextLink":"id(\"list_txt02\")//a[starts-with(text(),\"\u6b21\")]", | |
| "wedata.net.id":25870 | |
| }, | |
| { | |
| "url":"^http://chiebukuro\\.yahoo.co\\.jp/(?:list/|dir/list|tag)", | |
| "pageElement":"(id('yschnpg')/following-sibling::ul|//ul[@class='lst_tg'])/li", | |
| "nextLink":"id('yschnpg')//a[contains(@class,'next')]|id('pg')//li[last()]/a", | |
| "wedata.net.id":27769 | |
| }, | |
| { | |
| "url":"^http://ukdata\\.blog38\\.fc2\\.com(/page-[\\d]+\\.html)?", | |
| "pageElement":"//div[@class=\"contents_body\"]", | |
| "nextLink":"//a[contains(text(), \"Next »\")]", | |
| "wedata.net.id":76323 | |
| }, | |
| { | |
| "url":"^http://lumino\\.sblo\\.jp/article/(\\d{7}|\\d{8})\\.html", | |
| "pageElement":"id(\"content\")/div[contains(concat(\" \", @class, \" \"), \" blog \")]", | |
| "nextLink":"//div[@class=\"navi\"]/a[last()][not(self::a/@href=\"http://lumino.sblo.jp/\")]", | |
| "wedata.net.id":54851 | |
| }, | |
| { | |
| "url":"^http://www\\.nikkeibp\\.co\\.jp/article/(?:nba|skillup)/", | |
| "pageElement":"//div[@class=\"text\"]", | |
| "nextLink":"//a[@class=\"next\"]", | |
| "wedata.net.id":27973 | |
| }, | |
| { | |
| "url":"^http://kc\\.kodansha\\.co\\.jp/magazine/news_list\\.php/", | |
| "pageElement":"id(\"more-book\")", | |
| "nextLink":"//p[@class=\"result-hit-page\"]/b/following-sibling::a[1]", | |
| "wedata.net.id":49902 | |
| }, | |
| { | |
| "url":"^https?://(www\\.)?enterbrain\\.co\\.jp/(search|product|)", | |
| "pageElement":"id('content')//*[td or self::dl]", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":55544 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?mantan-web\\.jp/[^/?#]+/archive\\.html", | |
| "pageElement":"//ul[@class='genrearchive__list']/li|//div[contains(concat(' ',@class,' '), ' archiveCalender ')]/following-sibling::*[following-sibling::div[contains(concat(' ',@class,' '), ' datePagination ')]]", | |
| "nextLink":"//li[@class='pagination-current']/following-sibling::li[1]/a", | |
| "wedata.net.id":2391 | |
| }, | |
| { | |
| "url":"^http://www\\.imdb\\.com/((name|title)/(nm|tt)\\d+/)?news", | |
| "pageElement":"id('main')/a[h2]/preceding-sibling::hr[1]/following-sibling::*[following-sibling::hr[last()-1]]|id('main')/a[h2]/preceding-sibling::hr[1]|id('tn15content')/*[preceding-sibling::p[1]][following-sibling::hr[last()-1]]", | |
| "nextLink":"id('main tn15content')/p/a[.='Next »']|(id('main')/a[.='« Prev']|id('tn15content')/strong/following-sibling::a[1])[not(id('main tn15content')/p/a='Next »')]", | |
| "wedata.net.id":74672 | |
| }, | |
| { | |
| "url":"^http://www2\\.nhk\\.or\\.jp/cgisearch/wbs/query\\.cgi\\?", | |
| "pageElement":"//div[@class='resultData']//tr", | |
| "nextLink":"//a[@class=\"next\"]", | |
| "wedata.net.id":34164 | |
| }, | |
| { | |
| "url":"^http://www5\\.big\\.or\\.jp/~seraph/ragna/ragna\\.cgi\\?", | |
| "pageElement":"//table[@summary='result']/tbody/tr[td]", | |
| "nextLink":"//div[@class='main']/p[last()]/span[not(a)]/following-sibling::span/a", | |
| "wedata.net.id":32823 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?barefootrunning\\.fas\\.harvard\\.edu/", | |
| "pageElement":"//table[@align='center']/tbody/tr[.//h2]/td/*[not(@id='table2')]", | |
| "nextLink":"//td[@class='nextLink']/a", | |
| "wedata.net.id":34058 | |
| }, | |
| { | |
| "url":"^https?://www\\.nintendo\\.co\\.jp/.+/(?:crv|interview)/.", | |
| "pageElement":"id(\"int-box-wrap main-visual\")/*|//div[@class=\"hero-container\"]|//ul[@class=\"interview__pagination\"]/preceding-sibling::*", | |
| "nextLink":"id(\"page-next\")/a|//li[@class=\"pagination-next\"]/a", | |
| "wedata.net.id":33778 | |
| }, | |
| { | |
| "url":"^http://r\\.gnavi\\.co\\.jp/g-interview/archive/category/", | |
| "pageElement":"//div[@class=\"archive-entries\"]", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":80919 | |
| }, | |
| { | |
| "url":"^https?://www\\.chikumashobo\\.co\\.jp/(?:author|search)/", | |
| "pageElement":"id(\"result-lists\")/div[@id='result']", | |
| "nextLink":"//li[@class=\"next\"]/a[text()=\"次へ\"]", | |
| "wedata.net.id":63191 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?showyourdick\\.org/cocks_archive\\.php", | |
| "insertBefore":"//table/tbody/tr/td/table/tbody/tr[not(following-sibling::tr)]", | |
| "pageElement":"//table/tbody/tr/td/table/tbody/tr", | |
| "nextLink":"//table/tbody/tr/td/table/tbody/tr/td/h2/a", | |
| "wedata.net.id":29724 | |
| }, | |
| { | |
| "url":"^http://twed2k\\.org/(?:forumdisplay|viewthread)\\.php\\?", | |
| "pageElement":"//div[@class='maintable'][not(form)][table[@class='tableborder'][@style='margin-top:-1px;border-bottom:none;border-top:none']]|//form[@name='delpost']/div[@class='maintable']", | |
| "nextLink":"//td[@class=\"pagenumstatic\"]/following-sibling::td[1]/a", | |
| "wedata.net.id":48844 | |
| }, | |
| { | |
| "url":"^http://challenge-your-limits2?\\.herokuapp\\.com/winners", | |
| "pageElement":"//table/tbody/tr", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":77749 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?mr-lee-catcam\\.de/pe_catcam\\d+\\.htm", | |
| "pageElement":"//center/table//center/table", | |
| "nextLink":"//a[text()=\"Continue to next trip\"]", | |
| "wedata.net.id":2848 | |
| }, | |
| { | |
| "url":"^http://(?:tanizawatomofumi\\.com|tnzwtmfm\\.jugem\\.cc)/", | |
| "pageElement":"//article", | |
| "nextLink":"//span[@class='pager_next']/a", | |
| "wedata.net.id":28966 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?imagefap\\.com/(?:pics/|gallery\\.php)", | |
| "pageElement":"//div[@class='gallerylist']", | |
| "nextLink":"//a[@class='link3' and (text()=':: next ::')]", | |
| "wedata.net.id":37447 | |
| }, | |
| { | |
| "url":"^http://norakono\\.web\\.fc2\\.com/\\w+/[a-z]+\\d+\\.html", | |
| "pageElement":"//img[@alt=\"inserted by FC2 system\"]/preceding-sibling::*", | |
| "nextLink":"//a[@href=\"http://norakono.web.fc2.com/\"]/following-sibling::a[last()][not(@href=\"http://norakono.web.fc2.com/menu.html\")]", | |
| "wedata.net.id":50928 | |
| }, | |
| { | |
| "url":"^https://www\\.library\\.city\\.sapporo\\.jp/licsxp-opac/", | |
| "pageElement":"id(\"Main\")//table[@class=\"list\"]/tbody/tr", | |
| "nextLink":"id(\"Main\")//span[@class=\"cur\"]/following-sibling::a[1]", | |
| "wedata.net.id":53368 | |
| }, | |
| { | |
| "url":"^https?://(comic|matome|search|movie)\\.naver\\.(jp|com)/", | |
| "pageElement":"//div[contains(@class,\"mdMTMEnd01Wrap\") or @class=\"wt_viewer\"]|//div[contains(@class,\"MdMTMWidgetList01\")]/*|id(\"elThumbnailResultArea\")/li|//table[@class=\"list_ranking\"]/tbody/tr|//ul[@class=\"MdMTMTtlList03\" or @class=\"mdTopMTMList01List\"]/li", | |
| "nextLink":"//a[@data-na=\"NC:next\" or contains(@class,\"Next\") or (.|..)/@class=\"next\" or @class=\"btn_next\"]|//div[@data-na=\"NA:pager\" or contains(@class,\"Pagination\")]/strong/following-sibling::a[1][not(@href=\"#\")]", | |
| "wedata.net.id":60489 | |
| }, | |
| { | |
| "url":"^http://propaganda-party\\.com/(pages/gallery|image/\\d+)", | |
| "pageElement":"//div[@id='links']|//div[@class='row gallerys']/preceding-sibling::h1|//article//div[@class='cont']/a[img]", | |
| "nextLink":"//a[@rel=\"next\"]|//div[@class=\"remote\"]/a[last()][not(contains(@href,\"page:\"))]", | |
| "wedata.net.id":65649 | |
| }, | |
| { | |
| "url":"^https://((?:aichi|tokyo|osaka)\\.)?thepage\\.jp/detail/", | |
| "pageElement":"id(\"main\")/article[@class=\"article-detail\"]/div[@class=\"bd\"]//section[@class=\"article-detail-paragraph\"]", | |
| "nextLink":"//ul[@class=\"pagelist\"]/li[span]/following-sibling::li/a", | |
| "wedata.net.id":74081 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?demonstrations\\.wolfram\\.com/search", | |
| "pageElement":"//table[@class='searchresults-table']//tr", | |
| "nextLink":"//b[@class='page_current']/following-sibling::a[1]", | |
| "wedata.net.id":54396 | |
| }, | |
| { | |
| "url":"^http://www\\.designfesta\\.com/exhibitors/introduction/", | |
| "pageElement":"id(\"contener-about\")//ul[not(@class)]/li", | |
| "nextLink":"//div[@class=\"pager\"]/span[not(@class)]/following-sibling::a", | |
| "wedata.net.id":76873 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?gamemeter\\.net/(?:s|u/\\d+/gamelist)", | |
| "pageElement":"//div[@class='book']", | |
| "nextLink":"//center/a[contains(.,'→next')]", | |
| "wedata.net.id":27030 | |
| }, | |
| { | |
| "url":"^http://weiqi\\.sports\\.tom\\.com/php/listqipu.*\\.html", | |
| "pageElement":"//ul[@class=\"title\"]/following-sibling::*[following::div[@class=\"pagenum\"]]", | |
| "nextLink":"//div[@class=\"pagenum\"]/a[contains(text(),\"\u4e0b\")]", | |
| "wedata.net.id":31282 | |
| }, | |
| { | |
| "url":"http://mediafactory\\.jp/Form/Product/ProductList\\.aspx", | |
| "pageElement":"id(\"pagination\")/following-sibling::div[contains(concat(\" \", @class, \" \"), \" listProduct \")]", | |
| "nextLink":"//li[@class=\"next\"]/a", | |
| "wedata.net.id":64692 | |
| }, | |
| { | |
| "url":"^https?://(?:www\\.)?yandex\\.[a-z]{2,4}/(?:yand)?search", | |
| "pageElement":"//*[@class=\"serp-item\"]", | |
| "nextLink":"//a[contains(@class,\"kind_next\")]", | |
| "wedata.net.id":793 | |
| }, | |
| { | |
| "url":"^http://www\\.mangaoh\\.co\\.jp/ext/search_product\\.php", | |
| "pageElement":"//div[@class='span6']/*[@class='media' or self::hr]", | |
| "nextLink":"//li[@class='active notranslate']/following-sibling::li[1]/a", | |
| "wedata.net.id":57730 | |
| }, | |
| { | |
| "url":"^http://www\\.chuokoron\\.jp/\\d+/\\d+/post_[^/]+\\.html", | |
| "pageElement":"id(\"pickup_left\")/p", | |
| "nextLink":"id(\"pickup_left\")//li[@class=\"next\"]/a", | |
| "wedata.net.id":40736 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?mysku\\.ru(?:/\\index/\\page\\d+\\/)?", | |
| "pageElement":"//*[@id=\"content\"]/div[@class=\"topic\"]", | |
| "nextLink":"//*[@id=\"pagination\"]/li[2]/a", | |
| "wedata.net.id":80915 | |
| }, | |
| { | |
| "url":"^http://mitarashimanga\\.sarashi\\.com/s\\d+-\\d+\\.html", | |
| "pageElement":"id(\"other_page\")/node()", | |
| "nextLink":"id(\"other_page\")/a[@href=\"mangatop.html\"]/preceding-sibling::a[position()=1 and text()!=\"\u524d\u3078\"]", | |
| "wedata.net.id":40758 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?etorrent\\.co\\.kr/bbs/board\\.php\\?", | |
| "pageElement":"id('mw_basic')/table/tbody/tr[td/span/@class='mw_basic_list_num']", | |
| "nextLink":"//td[@class='mw_basic_page']/b/following-sibling::a[1]", | |
| "wedata.net.id":54189 | |
| }, | |
| { | |
| "url":"^http://www\\.crunchyroll\\.com/forum(?:topic|category)-", | |
| "pageElement":"id('template_body')//tr[td]", | |
| "nextLink":"//a[@class=\"paginator-lite\" and @title=\"Next\"]", | |
| "wedata.net.id":74912 | |
| }, | |
| { | |
| "url":"^http://shop\\.lesportsac\\.co\\.jp/ls/goods/list\\.html", | |
| "pageElement":"id('goodsData')/div", | |
| "nextLink":"//a[@class='pageMove'][contains(img/@src,'/page_next.gif')]", | |
| "wedata.net.id":63647 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?net-sprout\\.com/bandstory/.+?\\.html", | |
| "pageElement":"//div/table[1]", | |
| "nextLink":"//a[child::img[contains(@src, \"next.gif\") or contains(@src, \"next3.gif\")] or text()=\"\u6b21\u306e\u30a8\u30d4\u30bd\u30fc\u30c9\u3078\"]", | |
| "wedata.net.id":1976 | |
| }, | |
| { | |
| "url":"^http://tokyomangalab\\.com/(?:[^/]*[\\?&])?interviews=?", | |
| "pageElement":"//div[@class=\"post-content\"]|//div[@class=\"post-meta post-header\" or @class=\"featured-image \"][number(substring-after(id(\"nextpage\")/span/text(),\"ページ \"))=1]", | |
| "nextLink":"id(\"nextpage\")/span/following-sibling::a|//link[@rel=\"next\"][not(id(\"nextpage\")/span/following-sibling::a)]", | |
| "wedata.net.id":75037 | |
| }, | |
| { | |
| "url":"^http://k-tai\\.impress\\.co\\.jp/docs/column/stapablog/", | |
| "pageElement":"//div[@class=\"contents stapablog\"]", | |
| "nextLink":"//div[@class=\"paging\"]/a", | |
| "wedata.net.id":61663 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?ppomppu\\.co\\.kr/zboard/zboard\\.php", | |
| "pageElement":"//tr[td/@class='list_vspace']", | |
| "nextLink":"//font[@class='page_inert']/following-sibling::a[1]", | |
| "wedata.net.id":54156 | |
| }, | |
| { | |
| "url":"^http://search\\.books\\.com\\.tw/exep/prod_search\\.php", | |
| "pageElement":"//ul[@class=\"searchbook\"]", | |
| "nextLink":"//a[@class=\"nxt\"]", | |
| "wedata.net.id":40954 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?argos\\.(?:co\\.uk|ie)/static/Browse/", | |
| "pageElement":"id('switchview')/ol", | |
| "nextLink":"//span[@class='pagenum active']/following-sibling::a[1]", | |
| "wedata.net.id":33136 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?baidu\\.(?:[^.]{2,3}\\.)?[^./]{2,3}/s", | |
| "pageElement":"//div[@class='result c-container ']", | |
| "nextLink":"//a[@class='n']", | |
| "wedata.net.id":425 | |
| }, | |
| { | |
| "url":"^https?://(?:[^/]+\\.)?google(?:\\.\\w{2,3}){1,2}/movies", | |
| "pageElement":"id(\"movie_results\")/*", | |
| "nextLink":"id(\"pnnext\")|id(\"navbar navcnt nav\")//td[span]/following-sibling::td[1]/a|id(\"nn\")/parent::a", | |
| "wedata.net.id":58112 | |
| }, | |
| { | |
| "url":"^https?://github\\.com/(?:changelog|[^/]+/[^/]+/commits)", | |
| "pageElement":"//*[starts-with(@class,\"commit-group\")]", | |
| "nextLink":"//a[contains(text(), \"Older\")]", | |
| "wedata.net.id":1218 | |
| }, | |
| { | |
| "url":"^http://blog\\.hatena\\.ne\\.jp/-/campaign/[^/]+/entries", | |
| "pageElement":"//li[@class=\"campaign-blog-entry\"]", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":76419 | |
| }, | |
| { | |
| "url":"^http://www\\.tele\\.soumu\\.go\\.jp/musen/SearchServlet", | |
| "pageElement":"//table[@class='borderstyle' and .//td[@width='25%'][@align='center']]//tr[1]/following-sibling::tr", | |
| "nextLink":"//a[img/@alt='次へ']", | |
| "wedata.net.id":64704 | |
| }, | |
| { | |
| "url":"^https://jp\\.match\\.com/search/searchsubmit\\.aspx\\?", | |
| "pageElement":"//div[@class='results ']/div[starts-with(@class,'card ')]", | |
| "nextLink":"//strong[@class='ui-paging-current']/following-sibling::a[1]", | |
| "wedata.net.id":26928 | |
| }, | |
| { | |
| "url":"(http|https)://(m\\.)?(cams|adultfriendfinder)\\.com/.+", | |
| "pageElement":"id(\"show_photos\")/table | id(\"gallery\")/div | //div[@class=\"gallery_thumbs\"] | id(\"photos\")", | |
| "nextLink":"id(\"show_photos_nav\")/descendant::td[number(translate(text(), \"<>\", \"\"))>0]/following::td[1]/a | //*[@id=\"gallery_nav\"]/div/table/tbody/tr/td/a[text()=\"Next\"] | //a[text()=\"Next\"]", | |
| "wedata.net.id":55332 | |
| }, | |
| { | |
| "url":"^http://doda\\.jp/DodaFront/View/JobSearchList\\.action", | |
| "pageElement":"//div[@class='search_box']/*[@class='company_box' or @name]", | |
| "nextLink":"//li[a/@class='active_link']]/following-sibling::li/a", | |
| "wedata.net.id":64774 | |
| }, | |
| { | |
| "url":"^http://kato-manga\\.sakura\\.ne\\.jp/.+[0-9]{2}\\.html", | |
| "pageElement":"//center[descendant::img]", | |
| "nextLink":"//a[.='次へ' or .='NEXT' or descendant::img[contains(@src,'NEXT.jpg')]]", | |
| "wedata.net.id":2615 | |
| }, | |
| { | |
| "url":"^http://www\\.geocities\\.jp/obokusama/\\d+/\\d+\\.htm$", | |
| "pageElement":"//center", | |
| "nextLink":"//center/a[not(contains(@href,'index.htm'))][last()]", | |
| "wedata.net.id":72709 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?ala(?:bout|fs)\\.com/s?list\\.php\\?", | |
| "pageElement":"//hr[@size=\"1\"]/following-sibling::*[following-sibling::hr[@class=\"thread_separator\"][last()]]", | |
| "nextLink":"//a[@class=\"page_off\"]/following-sibling::b/following-sibling::a[1]|//a[@class=\"page_off\"][1][./preceding-sibling::b]", | |
| "wedata.net.id":27889 | |
| }, | |
| { | |
| "url":"^http://shop\\.orion\\.de/epages/orion_DE\\.storefront/", | |
| "pageElement":"id(\"b_center\")/div[@class=\"bc_slide\"]//div[contains(concat(\" \", @class, \" \"), \" bc_lt_product \")]", | |
| "nextLink":"id(\"b_center\")/div[@class=\"bc_slide\"]//a[@class=\"button_right\"]", | |
| "wedata.net.id":33165 | |
| }, | |
| { | |
| "url":"^http://cse\\.naro\\.affrc\\.go\\.jp/takezawa/r-tips/r/", | |
| "pageElement":"//p[a/img/@src='image/icon5.gif'][1]/following-sibling::*[following-sibling::p/a/img/@src='image/icon5.gif']", | |
| "nextLink":"//a[img/@src='image/icon5.gif']", | |
| "wedata.net.id":27903 | |
| }, | |
| { | |
| "url":"^http://www\\.aqrs\\.jp/cgi-bin/ghostdb/search\\.cgi\\?", | |
| "pageElement":"//table/tbody/tr", | |
| "nextLink":"//table/following-sibling::div[1]/text()[contains(.,'Page ')]/following-sibling::a[1]", | |
| "wedata.net.id":39981 | |
| }, | |
| { | |
| "url":"^http://www\\.nikkeibp\\.co\\.jp/style/biz/[^/]+/[^/]+/", | |
| "pageElement":"id('m_body')/*[preceding-sibling::div/@id='mb_title'][following-sibling::ul/@id='pages_v2']", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":1222 | |
| }, | |
| { | |
| "url":"^http://www\\.asahi-net\\.or\\.jp/~kc7k-nd/onlispjhtml/", | |
| "pageElement":"//hr/preceding-sibling::node()", | |
| "nextLink":"//a[@href='index.html']/following-sibling::a|//ul/li/a", | |
| "wedata.net.id":55878 | |
| }, | |
| { | |
| "url":"^http://www\\.google\\.co(?:\\.jp|m)/intl/ja/ime/comic/", | |
| "pageElement":"//div[contains(concat(\" \", @class, \" \"), \" pages \")]", | |
| "nextLink":"//div[contains(concat(\" \", @class, \" \"), \" pageselect \")]/select/following-sibling::a", | |
| "wedata.net.id":38640 | |
| }, | |
| { | |
| "url":"^http://dreamaker\\.jp/(?:dream|materials/(?:chara|bg))", | |
| "pageElement":"id('dreamIndex materialIndex')/li", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":62603 | |
| }, | |
| { | |
| "url":"^https://www\\.lib\\.toyonaka\\.osaka\\.jp/licsxp-opac/", | |
| "pageElement":"id(\"Main\")//table[@class=\"list\"]/tbody/tr", | |
| "nextLink":"id(\"Main\")//span[@class=\"cur\"]/following-sibling::a[1]", | |
| "wedata.net.id":27379 | |
| }, | |
| { | |
| "url":"^http://www\\.geocities\\.jp/santaigreen/08hase-itiran/", | |
| "pageElement":"//table", | |
| "nextLink":"//table//tbody//td[last()]//a", | |
| "wedata.net.id":29677 | |
| }, | |
| { | |
| "url":"^http://www\\.itmedia\\.co\\.jp/enterprise/(?!articles)", | |
| "pageElement":"//h3[@class=\"cmstitle\"]/following-sibling::*[following::p[descendant::a and descendant::b]]", | |
| "nextLink":"//a[text()=\"\u6b21\u306e\u30da\u30fc\u30b8\"]", | |
| "wedata.net.id":40549 | |
| }, | |
| { | |
| "url":"^http://novelcom\\.syosetu\\.com/impression/list/ncode/", | |
| "pageElement":"id('contents_main')/div[@class=\"waku\"]", | |
| "nextLink":"//a[contains(text(), \"Next >>\")][1]", | |
| "wedata.net.id":74537 | |
| }, | |
| { | |
| "url":"^http://www\\.1335mmunderbar\\.com/SS/\\w+\\d{3}\\.html", | |
| "pageElement":"//p[@class='NOVEL']/a/preceding-sibling::node()", | |
| "nextLink":"//a[contains(.,'(続く)')]", | |
| "wedata.net.id":39569 | |
| }, | |
| { | |
| "url":"^http://kasikoinu\\.web\\.fc2\\.com/mannga/m\\d+\\.html", | |
| "pageElement":"//p[img][1]", | |
| "nextLink":"//a[img/@src='../gazou/su.gif']", | |
| "wedata.net.id":38805 | |
| }, | |
| { | |
| "url":"^http://www\\.shopping-search\\.jp/cgi-bin/search\\.cgi", | |
| "pageElement":"id('grid')/*", | |
| "nextLink":"//p[@class='next']/a", | |
| "wedata.net.id":64778 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?autumnleaf\\.jp/shop/show_unit\\.php", | |
| "insertBefore":"//center//center/table[4]", | |
| "pageElement":"//center//center/table[3]", | |
| "nextLink":"//center//center/table[4]//td[2]//a", | |
| "wedata.net.id":27156 | |
| }, | |
| { | |
| "url":"^http://chiebukuro\\.search\\.yahoo\\.co\\.jp/search\\?", | |
| "pageElement":"//ol[@class='cl']/li", | |
| "nextLink":"id('Sp1')//strong/following-sibling::a[1]", | |
| "wedata.net.id":2218 | |
| }, | |
| { | |
| "url":"^http://yumeminosora\\.web\\.fc2\\.com/[^/]+\\d+\\.html", | |
| "pageElement":"//font[@color=\"#ccccff\"][./img]/*|//font[@color=\"#ccccff\"]/following-sibling::*[self::img[not(@alt=\"inserted by FC2 system\")] or self::br or self::big or self::b]|//font[@color=\"#ccccff\"]/preceding-sibling::*[self::img or self::br]|//div[@style=\"text-align: center;\"][not(./font[@color=\"#ccccff\"])]/font[@color=\"#990000\"][last()]/following-sibling::*", | |
| "nextLink":"//div/descendant::img/following::a[@href and not(contains(@href, 'rank') or contains(@href,'index') or @href='http://fc2.com/')]|//big//a[1][not(@href='index.html')]", | |
| "wedata.net.id":39790 | |
| }, | |
| { | |
| "url":"^http://valhalla-gate.gree-pf.net/Battle/HistoryDetail/", | |
| "pageElement":"//*[@id=\"content-body\"]/div[2]", | |
| "nextLink":"//*[@id=\"content-body\"]/ul[2]/li[@class=\"white-pagination_item white-pagination_item-Active\"]/following-sibling::li/div/a", | |
| "wedata.net.id":77077 | |
| }, | |
| { | |
| "url":"^http://news\\.livedoor\\.com/(article|topics)/category", | |
| "pageElement":"//ul[@class='articleList']/li", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":60293 | |
| }, | |
| { | |
| "url":"^http://www\\.toranoana\\.jp/cgi-bin/R2/allsearch\\.cgi", | |
| "pageElement":"//div[@class='item_list']//tr", | |
| "nextLink":"//div[@class='current']/followng-sibling::a[1]", | |
| "wedata.net.id":2630 | |
| }, | |
| { | |
| "url":"^http://[^.]+\\.tamiya-plamodelfactory\\.co\\.jp/blog/", | |
| "pageElement":"//div[@class=\"section entry\"]", | |
| "nextLink":"//div[@class=\"wp-pagenavi\"]/a[starts-with(text(), \"\u6b21\u30da\u30fc\u30b8\")]", | |
| "wedata.net.id":29021 | |
| }, | |
| { | |
| "url":"^http://live\\.xbox\\.com/[^/]+/profile/Friends\\.aspx", | |
| "pageElement":"//div[@id=\"XbcShellBody\"]/div[@class=\"XbcProfileTableContainer\"]/table[@class=\"XbcProfileTable XbcFriendsListTable\"]", | |
| "nextLink":"//div[@id=\"XbcPag\"]/a[@class=\"XbcNP\"]", | |
| "wedata.net.id":1322 | |
| }, | |
| { | |
| "url":"^https?://www\\.bittersweetcandybowl\\.com/candybooru/", | |
| "pageElement":"//div[@class='thumbnailcontainer']", | |
| "nextLink":"id('paginator')/b/following-sibling::a[1]", | |
| "wedata.net.id":55486 | |
| }, | |
| { | |
| "url":"^http://(?:\\w+\\.)?freeones\\.(?:[a-z]{2,3}|co\\.uk)/", | |
| "pageElement":"//div[contains(@class,\"BI5col\") or @class=\"video_thumb videothumb\"]|//div[@class=\"ContentBlockBody Block3\"]//tr[./td]|//div[./div[@class=\"babedata\"]]", | |
| "nextLink":"//span[contains(concat(' ', @class, ' '), ' NextPage ')]/a", | |
| "wedata.net.id":64892 | |
| }, | |
| { | |
| "url":"^http://shop\\.beams\\.co\\.jp/.+/search_result\\.html", | |
| "pageElement":"id('main_area')/div/ul", | |
| "nextLink":"//span[@class='next']/a", | |
| "wedata.net.id":47912 | |
| }, | |
| { | |
| "url":"^http://www\\.(?:221b\\.jp|freeenglish\\.jp/holmes)/h/", | |
| "pageElement":"//div[@class=\"JaOuterFrame\" or @class=\"MoOuterFrame\"]", | |
| "nextLink":"//table[@summary=\"page\"]/tbody/tr/td/a[img[@alt=\"right arrow\"]]", | |
| "wedata.net.id":56392 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?hobbyjapan\\.co\\.jp/hobby-channel/", | |
| "pageElement":"id(\"content_box\")/div[contains(concat(\" \", @class, \" \"), \" post \")]", | |
| "nextLink":"//li[@class=\"current\"]/following-sibling::*[1][self::li]/a", | |
| "wedata.net.id":61442 | |
| }, | |
| { | |
| "url":"^http://www\\.osakaya\\.co\\.jp/(news|contents/search)", | |
| "pageElement":"//div[@class='post' or @class='section']", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":49321 | |
| }, | |
| { | |
| "url":"^http://www\\.nicovideo\\.jp/(?:my|user/\\d)(?:/top)?$", | |
| "pageElement":"//div[@class=\"timeline\"]/div", | |
| "nextLink":"//a[@class=\"next-page-link\"]", | |
| "wedata.net.id":41268 | |
| }, | |
| { | |
| "url":"^http://www\\.google\\.com/intl/ja/googlebooks/chrome/", | |
| "pageElement":"id(\"page\")/div[a[img] or img]", | |
| "nextLink":"id(\"info\")/p[contains(concat(\" \",@class,\" \"),\"nav\")]/a[img[@src=\"images/arrowright.gif\"]]", | |
| "wedata.net.id":55270 | |
| }, | |
| { | |
| "url":"^http://www.nanyodo\\.co\\.jp/php/diary_viewer_n\\.php", | |
| "pageElement":"//td[@class='left_td']/following-sibling::td/div/table", | |
| "nextLink":"//a[.='前の5件を表示']", | |
| "wedata.net.id":64906 | |
| }, | |
| { | |
| "url":"^http://www\\.mnemonicdictionary\\.com/wordlist\\.html", | |
| "pageElement":"id('home-middle-content')/div[@class='row-fluid']", | |
| "nextLink":"//div[@class='pagination']/ul/li[@class='active']/following-sibling::li[1]/a", | |
| "wedata.net.id":28297 | |
| }, | |
| { | |
| "url":"^https://mitpress\\.mit\\.edu/sicp/full-text/book/book", | |
| "pageElement":"(//div[contains(@class,'navigation')])[last()]/preceding-sibling::*[not(contains(@class,'navigation'))]", | |
| "nextLink":"//div[contains(@class,'navigation')]/span/a[starts-with(.,'next')]", | |
| "wedata.net.id":32766 | |
| }, | |
| { | |
| "url":"^http://(www\\.)?alistapart\\.com/(?:articles|search)/", | |
| "pageElement":"//*[self::ul/@class='entry-list' or self::h2/@class='alternate']|id(\"results\")", | |
| "nextLink":"//a[@class='previous' and (text()='Previous')]", | |
| "wedata.net.id":408 | |
| }, | |
| { | |
| "url":"^http://www\\.excite\\.co\\.jp/News/(?:photo_news/p-)?", | |
| "pageElement":"//div[@class=\"story\"]|id(\"contents\")/div[@class=\"inner\"]/div[contains(concat(\" \",@class,\" \"),\" section \")]//*[@class=\"mainPhoto\" or @class=\"photoCaption\"]", | |
| "nextLink":"//link[@rel=\"next\"]|//div[@class=\"section\"]/div[@class=\"thumb\"]//a|id(\"contents\")/div[@class=\"inner\"]/div/div[@class=\"newsImges\"]/a[( number(substring-before(substring-after(substring-after(substring-after(self::a/img/@src,\"/Excite\"),\"/E\"),\"_\"),\"_s.\")) > number(substring-before(substring-after(substring-after(substring-after(preceding-sibling::a/img/@src,\"/Excite\"),\"/E\"),\"_\"),\"_s.\"))+1 ) or ( number(substring-before(substring-after(substring-after(substring-after(self::a/img/@src,\"/Excite\"),\"/E\"),\"_\"),\"_s.\")) > number(substring-before(substring-after(substring-after(substring-after(parent::div/preceding-sibling::div[@class=\"photoGallery\"]/div[@class=\"mainPhoto\"]/img/@src,\"/Excite\"),\"/E\"),\"_\"),\".\")) )]|id(\"contents\")/div[@class=\"inner\"]/div/div[@class=\"newsImges\"]/a[@href=//div[@class=\"photoGallery\"]/span[@class=\"nextPhoto\"]/a/@href]|id(\"contents\")/div[contains(concat(\" \",@class,\" \"),\" relPhoto \")][div[@class=\"hgroup\"]/h2[not(a)]]//div[@class=\"thumb\"]//a|//div[@class=\"newsImges\"]/a[number(translate(./img/@src, \"abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ:/._\",\"\")) > number(translate(//div[@class=\"mainPhoto\"]/img/@src, \"abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ:/._\",\"\"))]|//div[@class=\"story\"]//p[@class=\"storyImg\"]/a", | |
| "wedata.net.id":39011 | |
| }, | |
| { | |
| "url":"^https://crosset\\.onward\\.co\\.jp/b/pc/Search\\.html", | |
| "pageElement":"//ul[@class='list165']/*", | |
| "nextLink":"//div[@class='p_nexst']/a", | |
| "wedata.net.id":65445 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?mcstories\\.com/(Titles|WhatWasNew)", | |
| "pageElement":"id('mcstories')/section|//div[@class='story']", | |
| "nextLink":"//h3[@class='trailer']/a|//nav[@class='arrows'][count(./a)>1 or ./a[@href='B.html']]/a[last()]", | |
| "wedata.net.id":33053 | |
| }, | |
| { | |
| "url":"^http://www\\.jvcmusic\\.co\\.jp/flyingdog/-/WhatsNew/", | |
| "pageElement":"//div[@class='whats_bn']", | |
| "nextLink":"//a[img/@id='btn_prev']", | |
| "wedata.net.id":64925 | |
| }, | |
| { | |
| "url":"^https://www\\.ddc\\.co\\.jp/estore/cgi/item/start.cgi", | |
| "pageElement":"//ul[@class=\"pager\"]/following-sibling::*[following-sibling::ul[@class=\"pager\"]]", | |
| "nextLink":"//ul[@class=\"pager\"]/li[contains(concat(\" \",@class,\" \"),\" here \")]/following-sibling::li/a", | |
| "wedata.net.id":66824 | |
| }, | |
| { | |
| "url":"^http://transit\\.loco\\.yahoo\\.co\\.jp/search/result", | |
| "pageElement":"id('srline')/div", | |
| "nextLink":"id('pg_bottom')/dd/a[contains(.,'次の')]", | |
| "wedata.net.id":31069 | |
| }, | |
| { | |
| "url":"^https?://www\\.find-job\\.net/fj/(?:search|new)\\.cgi", | |
| "pageElement":"//body/main/div[@class='container']/div[@itemscope]", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":1469 | |
| }, | |
| { | |
| "url":"^https?://(?:mail\\.nl\\.linux|lists\\.freebsd)\\.org/", | |
| "pageElement":"//h1[1] | //h1[1]/following-sibling::node()", | |
| "nextLink":"//a[text()=\"Thread Next\"][1] | //li[starts-with(normalize-space(), \"Next message:\")][1]/a", | |
| "wedata.net.id":30187 | |
| }, | |
| { | |
| "url":"^https://www\\.hatena\\.ne\\.jp/shop/benefit\\.comment", | |
| "pageElement":"id(\"body\")/div[@class=\"section\"]/ul[@class=\"commentlist\"]", | |
| "nextLink":"id(\"body\")/p[@class=\"pager\"]/a[@rel=\"next\"]", | |
| "wedata.net.id":27675 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?seikatsusoken\\.jp/futuretimeline/.", | |
| "pageElement":"id('ftsr_dataList')/li", | |
| "nextLink":"id('ft_sr_top')//li[span/@class='ftsr_pnav_li_selected']/following-sibling::li[1]//a", | |
| "wedata.net.id":30462 | |
| }, | |
| { | |
| "url":"^http://www\\.tsadult\\.net/[^/]*/(futaba|\\d+)\\.html", | |
| "pageElement":"//br[@clear=\"all\"]/preceding-sibling::hr[1]/preceding-sibling::node()|//center[form]/following-sibling::hr[1]", | |
| "nextLink":"//tr/td/b/following-sibling::a", | |
| "wedata.net.id":73794 | |
| }, | |
| { | |
| "url":"^http://www\\.toranoana\\.jp/cgi-bin/R2/d_search\\.cgi", | |
| "pageElement":"//table[@class=\"f_tbl_9cf\"]/following-sibling::table[@class=\"addrtbl\"][not(position()=last())]", | |
| "nextLink":"//td[@class=\"DTW_td_r\"]//b[contains(., \">\") and not(contains(., \">>\"))]/parent::a", | |
| "wedata.net.id":33181 | |
| }, | |
| { | |
| "url":"^http://www\\.tvgroove\\.com/news/new_jpn/ctg/2\\.html", | |
| "pageElement":"//div[@id='topnewsWL']/ul/ul", | |
| "nextLink":"//a[(text()='次へ→')]", | |
| "wedata.net.id":70087 | |
| }, | |
| { | |
| "url":"^http://www\\.honda\\.co\\.jp/gentsuki/asobi_guide/vol", | |
| "pageElement":"//div[contains(concat(\" \",@class,\" \"),\" gb-guide-entry \")]/div[@class=\"entry-body\"]", | |
| "nextLink":"//a[@class=\"next\"]", | |
| "wedata.net.id":77651 | |
| }, | |
| { | |
| "url":"^http://yu-hi\\.sakura\\.ne\\.jp/hinata/cgi-bin/gazou/", | |
| "pageElement":"//table[@align=\"right\"]/preceding-sibling::hr[1]/preceding-sibling::*[preceding-sibling::center]", | |
| "nextLink":"//table[@align=\"right\"]/following-sibling::table[1]//tr/form[@action][last()]", | |
| "wedata.net.id":77655 | |
| }, | |
| { | |
| "url":"^http://sportsmarketing-knowledge\\.jp/archives/[0-9]+", | |
| "pageElement":"id('article_body')//div[@itemprop='articleBody']/*[not(@class='pagesprit')]", | |
| "nextLink":"id('article_body')//div[@class='page-numbers']/span/following-sibling::a", | |
| "wedata.net.id":77755 | |
| }, | |
| { | |
| "url":"^https://(?:www\\.)?gay-torrents\\.org/torrents\\.php", | |
| "pageElement":"//table[@class='browse-tt']", | |
| "nextLink":"//table[@class='lista']/tbody/tr[3]/td/p/a[./b[contains(.,'Next')]]", | |
| "wedata.net.id":73802 | |
| }, | |
| { | |
| "url":"^http://www\\.bhphotovideo\\.com/c/(?:buy/|search\\?)", | |
| "pageElement":"//div[starts-with(@class,'item clearfix js-item')]", | |
| "nextLink":"//a[starts-with(@class='pn-next')]", | |
| "wedata.net.id":26672 | |
| }, | |
| { | |
| "url":"^http://dictionary\\.goo\\.ne\\.jp/srch/(?:ej|j[en])/", | |
| "pageElement":"id(\"incontents\")/dl[@class=\"allList\"]", | |
| "nextLink":"id(\"incontents\")/div[@class=\"paging\"]//span[@class=\"cur\"]/following-sibling::a[1]", | |
| "wedata.net.id":33174 | |
| }, | |
| { | |
| "url":"^https?://(?:www\\.)?bakabt\\.(?:me|com)/browse\\.php", | |
| "pageElement":"//table[@class='torrents']/tbody/tr", | |
| "nextLink":"//a[@class='selected'][last()]/following-sibling::a[1]", | |
| "wedata.net.id":39367 | |
| }, | |
| { | |
| "url":"http://api-x\\.idolwars\\.jp/arena/battle_timeline/.+", | |
| "pageElement":"//div[@id='arena']/section", | |
| "nextLink":"//div[@id='arena']/ul[2]/li[@class]//following-sibling::li[1]/a", | |
| "wedata.net.id":80957 | |
| }, | |
| { | |
| "url":"^https?://(?:[^./]+\\.){1,2}gamebase\\.com\\.tw/forum", | |
| "pageElement":"//table[@class='table_style thread']//tr[th][last()]/following-sibling::tr|id('forum_topic_list')/article", | |
| "nextLink":"//td[@class='next_page']/a", | |
| "wedata.net.id":55335 | |
| }, | |
| { | |
| "url":"^https?://www\\.giantitp\\.com/comics/oots\\d+\\.html", | |
| "pageElement":"//tr[contains(td/img/@src, \"/comics/\")]", | |
| "nextLink":"//a[img/@alt=\"Next Comic\"]", | |
| "wedata.net.id":56919 | |
| }, | |
| { | |
| "url":"^http://yomimonoweb\\.jp/kyomachiko/p\\d+_\\d+\\.html", | |
| "pageElement":"id(\"pnav\")/preceding-sibling::*", | |
| "nextLink":"id(\"pnav\")/p[last()]/node()[number(translate(self::text(), \"\u3000\", \" \"))>0]/following-sibling::a[1]", | |
| "wedata.net.id":50478 | |
| }, | |
| { | |
| "url":"^http://dim2database\\.blog38\\.fc2\\.com/blog-entry-", | |
| "pageElement":"//div[@class=\"content\"]", | |
| "nextLink":"//div[@class=\"page_navi\"]/a[last()][not(@href=\"http://dim2database.blog38.fc2.com/\")]", | |
| "wedata.net.id":76882 | |
| }, | |
| { | |
| "url":"^http://(?:segachu|oab)\\.sakura\\.ne\\.jp/gia/story/", | |
| "pageElement":"//table", | |
| "nextLink":"//a[(img and not(contains(@href, \"#\") or contains(@href, \"ranking\") or contains(@href, \"survey\"))) or contains(., \"次\") or .=\"NEXT\"]", | |
| "wedata.net.id":39999 | |
| }, | |
| { | |
| "url":"^http://www\\.cs\\.cmu\\.edu/Groups/AI/html/cltl/clm/", | |
| "pageElement":"//hr[2]/following-sibling::*[ following::hr[last()] ]", | |
| "nextLink":"//img[@alt=\"next\"]/..", | |
| "wedata.net.id":32837 | |
| }, | |
| { | |
| "url":"^http://news\\.baidu\\.(?:[^.]{2,3}\\.)?[^./]{2,3}/ns", | |
| "insertBefore":"//td[@class=\"zh\"]/../../../../*/following-sibling::node()[last()]", | |
| "pageElement":"//td[@class=\"zh\"]/../../..", | |
| "nextLink":"//div[@class=\"pg\"]/a[last()][child::font]", | |
| "wedata.net.id":427 | |
| }, | |
| { | |
| "url":"^http://ashiato\\.rakuten\\.co\\.jp/rms/sd/ashiato/vc", | |
| "pageElement":"id('itemList')/tbody", | |
| "nextLink":"//div[@class='pager']//li[last()]/em/following-sibling::a", | |
| "wedata.net.id":77692 | |
| }, | |
| { | |
| "url":"^http://www\\.(?:nyhash|sharedb)\\.info/index\\.php/.", | |
| "pageElement":"//div[@class='fileinfo' or @class='fileinfo_odd'][input]", | |
| "nextLink":"//a[contains(.,'次のページ')]", | |
| "wedata.net.id":2775 | |
| }, | |
| { | |
| "url":"^http://search\\.rakuten\\.co\\.jp/search/inshop-mall", | |
| "pageElement":"id('tableSarch')/table/tbody/tr[not(@style)]", | |
| "nextLink":"//a[contains(b,'次の')]", | |
| "wedata.net.id":77835 | |
| }, | |
| { | |
| "url":"^http://www\\.starchild\\.co\\.jp/artist/horie/diary/", | |
| "pageElement":"//table[@class=\"txt12\" and @width=\"608\"]", | |
| "nextLink":"//td[@bgcolor=\"#ffffff\"]/text()[not(normalize-space()=\"\")]/following-sibling::a[1]", | |
| "wedata.net.id":32283 | |
| }, | |
| { | |
| "url":"^(http|https)://(?:www|members)\\.livejasmin\\.com.+$", | |
| "pageElement":"id(\"allonline_content\")/*", | |
| "nextLink":"id(\"pagerContent\")/span[@class=\"allonlinepages_url\"]/following-sibling::a[1] | //a[@title=\"Next\"]rnrn", | |
| "wedata.net.id":32506 | |
| }, | |
| { | |
| "url":"^https://www\\.amazon\\.co\\.jp/gp/registry/wishlist*", | |
| "pageElement":"//div[starts-with(@id,\"guid\") and contains(@id, \"content\")]", | |
| "nextLink":"//*[@class=\"a-last\"]/a", | |
| "wedata.net.id":76364 | |
| }, | |
| { | |
| "url":"^http://bousai\\.tenki\\.jp/bousai/earthquake/entries", | |
| "pageElement":"id(\"earthquake_recent_entries_table\")", | |
| "nextLink":"//a[@class=\"move_next_link\"]", | |
| "wedata.net.id":64723 | |
| }, | |
| { | |
| "url":"^http://www\\.gentosha\\.jp/(articles|category|list)/", | |
| "pageElement":"id('article-body')/div[@id='pagination']/preceding-sibling::*|id('category-top-list')/div[starts-with(@class,'article-list clearfix')]", | |
| "nextLink":"//a[.='次のページ']rn", | |
| "wedata.net.id":74827 | |
| }, | |
| { | |
| "url":"^http://www\\.forest\\.impress\\.co\\.jp/img/wf/docs/", | |
| "pageElement":"id('main-image-wrap')", | |
| "nextLink":"//ul[@class='nav-02'][last()]/li[last()]/a", | |
| "wedata.net.id":76857 | |
| }, | |
| { | |
| "url":"^http://aonibi\\.sakura\\.ne\\.jp/\\D+\\d+\\D?\\.html", | |
| "pageElement":"id(\"bane\")/preceding-sibling::*", | |
| "nextLink":"id(\"gal\")/a[img]", | |
| "wedata.net.id":50929 | |
| }, | |
| { | |
| "url":"^http://dailynews\\.yahoo\\.co\\.jp/.+?/news_list/\\?", | |
| "pageElement":"id(\"detailNews\")/ul", | |
| "nextLink":"id(\"mainMargin\")/div[@class=\"pagelinkArea clr\"]/ul/li[@class=\"next\"]/a", | |
| "wedata.net.id":2428 | |
| }, | |
| { | |
| "url":"^http://search\\.shopping\\.yahoo\\.co\\.jp/search\\?", | |
| "pageElement":"id(\"mIn\")//div[@class=\"elList\"]/ul/li", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":587 | |
| }, | |
| { | |
| "url":"^http://www\\.amazon\\.co\\.jp/gp/cdp/member-reviews/", | |
| "pageElement":"//img[@alt='pixel'][@height='1']/preceding-sibling::table/following-sibling::*[not(@class='small')]", | |
| "nextLink":"//td[@class='small'][@align='right']/b/text()[string()!=' | '][2]/following-sibling::a|//td[@class='small'][@align='right']/b/a[position()=text()-1]", | |
| "wedata.net.id":29878 | |
| }, | |
| { | |
| "url":"^http://www\\.kumikyoku\\.jp/(?:collection|newsblog)/", | |
| "pageElement":"//div[@class=\"entry-unit\" or contains(concat(\" \", @class, \" \"), \" collection-body \")]", | |
| "nextLink":"//li[span[@class=\"current_page\"]]/following-sibling::li[1]/a | //a[img[@alt=\"次へ\"]]", | |
| "wedata.net.id":65449 | |
| }, | |
| { | |
| "url":"http://(?:www\\.)?xhamster(?:premiumpass)?\\.com/user", | |
| "pageElement":"id(\"video_title\")/div/* | //tr[td//div[contains(concat(' ', @class, ' '), ' galleryItem ') or contains(concat(' ', @class, ' '), ' dvdItem ') or contains(concat(' ', @class, ' '), ' favItem ') or contains(concat(' ', @class, ' '), ' actorItem ')]] | id('blog search_posts')/div[@class='post'] | //div[@class='boxC']/*[not(@class='pager')]", | |
| "nextLink":"//div[@class='pager']//a[@class='last colR' or @class='last'] | //span[@class='navNext']/a", | |
| "wedata.net.id":74976 | |
| }, | |
| { | |
| "url":"^http://(www\\.)?in-photoart\\.com/newsite/customers/", | |
| "pageElement":"//tr[td/@class='page']/preceding-sibling::tr[1]/descendant::table[1]/tbody/tr", | |
| "nextLink":"//a[./img[contains(@src,\"images/index/btn_next\")]]", | |
| "wedata.net.id":63725 | |
| }, | |
| { | |
| "url":"^http://park6\\.wakwak\\.com/~nakaya/q_dash/magazine/", | |
| "pageElement":"//a[.=\"NEXT\"]/parent::*/preceding-sibling::node()", | |
| "nextLink":"//a[.=\"NEXT\"]", | |
| "wedata.net.id":56068 | |
| }, | |
| { | |
| "url":"^http://pixivrank\\.net/ht2?/tag[0-9]+/p[0-9]+\\.html", | |
| "pageElement":"//table/tbody/tr/td/table[@class=\"p\"]//tr[td]", | |
| "nextLink":"//table/tbody/tr/td/p/a[contains(text(),\"次のページ→\")]", | |
| "wedata.net.id":32021 | |
| }, | |
| { | |
| "url":"^http://nme-jp\\.com/(?:blogs|reviews|features|news)/", | |
| "pageElement":"//div[contains(@class, \"post-content\")]/div[@class=\"wp-pagenavi\"]/preceding-sibling::*", | |
| "nextLink":"//a[contains(@class,\"nextpostslink\")]", | |
| "wedata.net.id":77743 | |
| }, | |
| { | |
| "url":"^http://www\\.forest\\.impress\\.co\\.jp/img/.+/html/", | |
| "pageElement":"//div[@class=\"view-large-pict-inner\"]/p/a", | |
| "nextLink":"//ul[@class=\"nav-linear\"]/li[@class=\"next\"]/a", | |
| "wedata.net.id":62141 | |
| }, | |
| { | |
| "url":"^http://forum\\.ru-board\\.com/(forum|topic)\\.cgi.+", | |
| "pageElement":"//tr[td[@class='poster']] | //table[@class='tb'][position()>1]", | |
| "nextLink":"//*[@class='small']/b/following-sibling::a[1]", | |
| "wedata.net.id":77826 | |
| }, | |
| { | |
| "url":"^http://www\\.actionscript\\.org/resources/articles/", | |
| "pageElement":"//div[@class=\"PostContent\"]", | |
| "nextLink":"//div[@class=\"ArtNavLeft\"]/span/following-sibling::a[1]", | |
| "wedata.net.id":32711 | |
| }, | |
| { | |
| "url":"^http://www\\.ele-king\\.net/(?:interviews|columns)/", | |
| "pageElement":"//div[contains(@class, \"EntryNavi\")]/preceding-sibling::*", | |
| "nextLink":"//*[contains(@class, \"EntryNavi\")]//span[not(a)]/following-sibling::*[1]/a", | |
| "wedata.net.id":76401 | |
| }, | |
| { | |
| "url":"^http://([^./]+\\.)?mmoloda(-[^./]+)?(\\.x0)?\\.com/", | |
| "pageElement":"id(\"listOffIndex paging2\")/preceding-sibling::table//tr[td]|id(\"paging2\")/preceding-sibling::div[@id=\"list\"]/table//tr[td]", | |
| "nextLink":"//td[@align='right']/a|id('paging2')/a[img/@alt='Old'][not(id('pageList')) or id('pageList')//a[1][not(@href)]]|//a[@class='active2']/following-sibling::a[1]", | |
| "wedata.net.id":77224 | |
| }, | |
| { | |
| "url":"^http://(blog|itemtrade|market)\\.hangame\\.co\\.jp/", | |
| "pageElement":"id('main')/div[@class='articleSection']|id('provide catalog')/*", | |
| "nextLink":"id('now')/following-sibling::li[1]/a|//li[@class='next']/a", | |
| "wedata.net.id":55190 | |
| }, | |
| { | |
| "url":"^http://www\\.gpara\\.com/article/corner_total\\.php", | |
| "pageElement":"//table[@class='mainbig']//div/preceding-sibling::a|//table[@class='mainbig']//div/preceding-sibling::a/following-sibling::br[1]|//table[@class='mainbig']//td/a/preceding-sibling::text()", | |
| "nextLink":"//div[@align=\"center\"]/span/following-sibling::a[1]", | |
| "wedata.net.id":62512 | |
| }, | |
| { | |
| "url":"^http://search\\.books\\.rakuten\\.co\\.jp/bksearch/", | |
| "pageElement":"//div[@class='rbcomp__item-list']/div", | |
| "nextLink":"//li[@class='active']/following-sibling::li[1]/a", | |
| "wedata.net.id":25603 | |
| }, | |
| { | |
| "url":"^http://kainavi\\.search\\.yahoo\\.co\\.jp/search\\?", | |
| "pageElement":"id('list_wrap')/div", | |
| "nextLink":"id('Sp1')/p/strong/following::a[1]", | |
| "wedata.net.id":59640 | |
| }, | |
| { | |
| "url":"^http://www\\.edion\\.com/(?:disp/)?CSfDispListPage_", | |
| "pageElement":"//div[@class='list-photo']", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":28892 | |
| }, | |
| { | |
| "url":"^http://www\\.ebest\\.co\\.jp/shop/goods/goods\\.asp", | |
| "pageElement":"//div[@class=\"listc\"]/*[not(self::p)]", | |
| "nextLink":"//a[contains(text(), \"\u6b21\u30da\u30fc\u30b8\")]", | |
| "wedata.net.id":28893 | |
| }, | |
| { | |
| "url":"^http://www7b\\.biglobe\\.ne\\.jp/\\~nipponsyokudou/", | |
| "pageElement":"//p[1]/following-sibling::node()", | |
| "nextLink":"//p/a[contains(concat(\" \",@href,\" \"),\" diary\")]", | |
| "wedata.net.id":60217 | |
| }, | |
| { | |
| "url":"^http://(?:blog\\.excite\\.co|[^.]+\\.exblog)\\.jp/?", | |
| "pageElement":"//div[@class=\"post\"]", | |
| "nextLink":"//a[@class=\"older_page\"]", | |
| "wedata.net.id":77062 | |
| }, | |
| { | |
| "url":"^http://ordermade\\.net/con/(?:sample|cr)_list\\.cgi", | |
| "pageElement":"//h1/following-sibling::div[./table]", | |
| "nextLink":"//img[@src=\"./image/next.gif\"]/parent::a", | |
| "wedata.net.id":25800 | |
| }, | |
| { | |
| "url":"^https?://(?:www\\.)?amusement-center\\.com/project/", | |
| "pageElement":"//div[contains(@class,'album clearfix')]|//div[@class='archiveindex']//tbody/tr[not(@class='more')]", | |
| "nextLink":"//a[.='>次へ' or .='次のページ']|//tr[@class='more']//strong[3]/following-sibling::a[1]", | |
| "wedata.net.id":1797 | |
| }, | |
| { | |
| "url":"https?://beta\\.babelzilla\\.org/projects/(?:\\?.*)?", | |
| "pageElement":"(//*[contains(concat(' ', @class, ' '), ' pagination ')])[1]/following-sibling::*[not(*[contains(concat(' ', @class, ' '), ' pagination ')])]", | |
| "nextLink":"(//*[@class='next'])[1]", | |
| "wedata.net.id":74536 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?ed-inter\\.co\\.jp/list\\.html\\?", | |
| "pageElement":"//div[contains( concat( \" \", @class, \" \" ), \" asset-contents \")]", | |
| "nextLink":"//div[contains( concat( \" \", @class, \" \" ), \" separator \")]/ul/li/a[contains( concat( \" \", @class, \" \" ),\" link_next \")]", | |
| "wedata.net.id":35353 | |
| }, | |
| { | |
| "url":"^http://latlonglab\\.yahoo\\.co\\.jp/macro/list\\.rb", | |
| "pageElement":"id(\"main\")/div", | |
| "nextLink":"//div[@class=\"contents\"]/a[last()]", | |
| "wedata.net.id":27224 | |
| }, | |
| { | |
| "url":"^https?://(?:www\\.)?asiandvdclub\\.org/browse\\.php", | |
| "pageElement":"//table[@class=\"torrenttable\"]", | |
| "nextLink":"//table[@class=\"mainouter\"]//div[@class=\"pages\"]/a[@title=\"next page\"]", | |
| "wedata.net.id":61370 | |
| }, | |
| { | |
| "url":"^http://www\\.itmedia\\.co\\.jp/news/subtop/archive/", | |
| "pageElement":"//div[@class='colBox colBoxBacknumber']//div[@class='colBoxInner']/*", | |
| "nextLink":"//div[contains(@class,'colBoxCarendar')]//li[@class='colBoxActive']/following-sibling::li[1]/a|//div[contains(@class,'colBoxCarendar')][.//@class='colBoxActive']/following-sibling::div[1]//li[1]/a[not(//div[contains(@class,'colBoxCarendar')]//li[@class='colBoxActive']/following-sibling::li[1]/a)]", | |
| "wedata.net.id":77616 | |
| }, | |
| { | |
| "url":"^https://www\\.r-i\\.co\\.jp/jpn/search/index\\.html", | |
| "pageElement":"id('search-result-01')/*", | |
| "nextLink":"id('next-01')", | |
| "wedata.net.id":65310 | |
| }, | |
| { | |
| "url":"^http://(kc|(www\\.)?bookclub)\\.kodansha\\.co\\.jp/", | |
| "pageElement":"//div[@class='comics-list clearfix' or @class='box clearfix' or @class='books-list clearfix']|//h3", | |
| "nextLink":"//li[@class='current']/following-sibling::li[not(@class='last')]/a[not(normalize-space()='>')]", | |
| "wedata.net.id":63182 | |
| }, | |
| { | |
| "url":"^http://ichi5c2\\.mint\\.aisnet\\.jp/\\w+/(?:\\w+/)?", | |
| "pageElement":"//*[self::center or (not(ancestor::center) and (self::div or self::p[not(parent::div)] or self::tr))]", | |
| "nextLink":"//a[(contains(., \"\u2192\") or contains(., \"\u6b21\")) and @href]", | |
| "wedata.net.id":25599 | |
| }, | |
| { | |
| "url":"^http://support\\.excite\\.co\\.jp/app/answers/list/", | |
| "pageElement":"id('rn_Multiline_9')//li", | |
| "nextLink":"id('rn_Paginator_10_Forward')", | |
| "wedata.net.id":63710 | |
| }, | |
| { | |
| "url":"^http://return0\\.dyndns\\.org/log/[^/]+/[^/]+/[^/]+", | |
| "pageElement":"//div[@class=\"section\"]/div[@class=\"section\"]", | |
| "nextLink":"id(\"navigation\")/p/a[text()=\"<<\"]", | |
| "wedata.net.id":2477 | |
| }, | |
| { | |
| "url":"^http://www\\.hitachi\\.co\\.jp/Prod/comp/soft1/omr/", | |
| "pageElement":"//div[@class='Section'][p]/*", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":63497 | |
| }, | |
| { | |
| "url":"^http://kuraki\\.livedoor\\.jp/archives/[^.]+\\.html", | |
| "pageElement":"id(\"articlebody\")", | |
| "nextLink":"//div[@class=\"menu\"]/a[starts-with(text(),\"\u524d\")]", | |
| "wedata.net.id":25591 | |
| }, | |
| { | |
| "url":"^http://www\\.dawgsdk\\.org/monashrine/gallery\\.php", | |
| "pageElement":"//td[@class='page-text']/table/tbody/tr", | |
| "nextLink":"//a[contains(.,'[次のページ]')]", | |
| "wedata.net.id":41039 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?sceper\\.(?:eu|ws)(?:/page/\\d+)?", | |
| "pageElement":"//div[@class='entry clearfix']", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":54430 | |
| }, | |
| { | |
| "url":"^https://my\\.redmine\\.jp/demo/projects/demo/issues", | |
| "pageElement":"//div[@class='autoscroll']//tbody/tr", | |
| "nextLink":"//li[@class='next page']/a", | |
| "wedata.net.id":63544 | |
| }, | |
| { | |
| "url":"^https://chromium\\.googlesource\\.com/.+?/src\\.git", | |
| "pageElement":"//ol[@class='CommitLog']/li", | |
| "nextLink":"//a[@class='LogNav-next']", | |
| "wedata.net.id":77228 | |
| }, | |
| { | |
| "url":"^http://www\\.viralchronicle\\.com/((?!category/).)+", | |
| "pageElement":"//div[@class='entry-content']/div[contains(nav/@class,'paging')]/preceding-sibling::*", | |
| "nextLink":"//div[@class='nav-next']/a", | |
| "wedata.net.id":76973 | |
| }, | |
| { | |
| "url":"^http://(zasshi\\.news|headlines)\\.yahoo\\.co\\.jp/", | |
| "pageElement":"//div[@class=\"paragraph\"]", | |
| "nextLink":"//li[@class=\"next\"]/a", | |
| "wedata.net.id":74118 | |
| }, | |
| { | |
| "url":"^http://(?:list|s|search[^.]*)\\.taobao\\.com/search", | |
| "pageElement":"//ul[@class='items grid clearfix']/li", | |
| "nextLink":"//a[@class='J_Ajax btn next']", | |
| "wedata.net.id":31253 | |
| }, | |
| { | |
| "url":"https?://www\\.soku\\.com/search_(video|playlist)/.+", | |
| "pageElement":"//div[@class='sk-vlist clearfix']/div", | |
| "nextLink":"//a[@title='下一页']", | |
| "wedata.net.id":72691 | |
| }, | |
| { | |
| "url":"^http://(shop|pc)\\.tsukumo\\.co\\.jp/(?:dir|search)", | |
| "pageElement":"//table[@class='itemData']|//div[@class='result']/*", | |
| "nextLink":"//span[contains(@class,'current')]/following-sibling::a[1]", | |
| "wedata.net.id":37383 | |
| }, | |
| { | |
| "url":"^https://cloud1\\.memsource\\.com/web/(job|project)/", | |
| "pageElement":"//div[@class='list']", | |
| "nextLink":"//a[@class='nextLink']", | |
| "wedata.net.id":74411 | |
| }, | |
| { | |
| "url":"^http://www\\.remus\\.dti\\.ne\\.jp/~a-satomi/nikki/", | |
| "pageElement":"id(\"shortCut\")/preceding-sibling::div[contains(concat(\" \", @class, \" \"), \" section \")]/div[contains(concat(\" \", @class, \" \"), \" section \")]", | |
| "nextLink":"//a[@rel=\"prev\"]", | |
| "wedata.net.id":42148 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?dieselsweeties\\.com/archive/\\d+", | |
| "pageElement":"//div[contains(img/@src,'/hstrips/')]", | |
| "nextLink":"//a[@title='read the next webcomic']", | |
| "wedata.net.id":57363 | |
| }, | |
| { | |
| "url":"^http://www\\.geocities\\.jp/teras_aa/.+\\d+\\.html$", | |
| "pageElement":"//dl", | |
| "nextLink":"//body/a[last()]", | |
| "wedata.net.id":63824 | |
| }, | |
| { | |
| "url":"^http://www\\.excite\\.co\\.jp/News/photo_news/\\w+/", | |
| "pageElement":"//div[@class=\"photoGallery\"]|//p[@class=\"photoCaption\"]", | |
| "nextLink":"//div[@class=\"newsImges\"]/a[number(translate(./img/@src, \"abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ:/._\",\"\")) > number(translate(//div[@class=\"mainPhoto\"]/img/@src, \"abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ:/._\",\"\"))]", | |
| "wedata.net.id":39012 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?tefutefu\\.jp/bbs/index[12]\\.cgi", | |
| "pageElement":"//center[./table[@width=\"90%\"]]/*", | |
| "nextLink":"//td/b[text()=concat(\"[\", count(./preceding-sibling::a)+1, \"]\")]/following-sibling::a[1]", | |
| "wedata.net.id":29505 | |
| }, | |
| { | |
| "url":"^http://store\\.tsutaya\\.co\\.jp/item/search_result", | |
| "pageElement":"//div[@class='itemDetail clearfix']", | |
| "nextLink":"//li[@class='pagerNext']/a", | |
| "wedata.net.id":26602 | |
| }, | |
| { | |
| "url":"^https://(?:www\\.)?thesocietypages\\.org/socimages/", | |
| "pageElement":"//div[@class='post-list']/div", | |
| "nextLink":"//a[@aria-label='Next']", | |
| "wedata.net.id":38320 | |
| }, | |
| { | |
| "url":"^http://shimmie\\.shishnet\\.org/v2/post/list(?:/|$)", | |
| "pageElement":"//div[@class='shm-image-list']/a", | |
| "nextLink":"//div[@class='blockbody']/b/following-sibling::a[1]", | |
| "wedata.net.id":32301 | |
| }, | |
| { | |
| "url":"^https://www\\.nintendo\\.co\\.jp/ir/library/events/", | |
| "pageElement":"//div[@class='set_table clearfix']", | |
| "nextLink":"//a[span/@class='next']", | |
| "wedata.net.id":32382 | |
| }, | |
| { | |
| "url":"^http://news\\.goo\\.ne\\.jp/(?:article|topstories)/", | |
| "pageElement":"//div[@class='nwbody']/*[.//*[text()='次のページ→' or text()='←前のページ']]/preceding-sibling::node()[not(.//*[text()='次のページ→' or text()='←前のページ'])]", | |
| "nextLink":"//a[contains(text(), \"次のページ\")]|id('incontents')/descendant::a[contains(text(), '続きを読む')][1]", | |
| "wedata.net.id":27502 | |
| }, | |
| { | |
| "url":"^http://www\\.chara-ani\\.com/(?:state)?list\\.aspx.", | |
| "pageElement":"//ul[@class='resultListup']/li", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":40952 | |
| }, | |
| { | |
| "url":"^http://webheibon\\.jp/blog/chagama/2008/01/1\\.html", | |
| "pageElement":"//div[starts-with(@id,\"entry-\")]", | |
| "nextLink":"//a[contains(text(),\"次\")]", | |
| "wedata.net.id":60719 | |
| }, | |
| { | |
| "url":"^https://www\\.amazon\\.co\\.jp/gp/css/order-history", | |
| "pageElement":"id(\"cs-orders\")/div[@class=\"action-box rounded\"]", | |
| "nextLink":"id(\"cs-orders\")/div/div/div/a[.=\"次へ »\"]", | |
| "wedata.net.id":65616 | |
| }, | |
| { | |
| "url":"^http://www\\.alphapolis\\.co\\.jp/content/sentence/", | |
| "pageElement":"//div[contains(concat(\" \",@class,\" \"),\" novel_body \")]", | |
| "nextLink":"//div[contains(concat(\" \",@class,\" \"),\" novel_link \")]/a[@class=\"next\"]", | |
| "wedata.net.id":80968 | |
| }, | |
| { | |
| "url":"^http://(www\\.)?(gizmodo\\.uol|kotaku)\\.com\\.br/", | |
| "pageElement":"id('loop-chamadas')/div[h2]", | |
| "nextLink":"//div[@class='navigation-next']/a", | |
| "wedata.net.id":77136 | |
| }, | |
| { | |
| "url":"^http://esearch\\.rakuten\\.co\\.jp/rms/sd/esearch/", | |
| "pageElement":"//tr[@bgcolor='#ff3300']/following-sibling::tr", | |
| "nextLink":"//a[b='次の30件']", | |
| "wedata.net.id":74150 | |
| }, | |
| { | |
| "url":"^http://www\\.guokr\\.com/(?:site|group|ask|event)/", | |
| "pageElement":"//ul[@class='titles' or @class='ask-list-cp' or @class='event_list gclear']", | |
| "nextLink":"//ul[@class='gpages']/li/a[contains(.,'下一页')]", | |
| "wedata.net.id":73810 | |
| }, | |
| { | |
| "url":"^https?://((.+)\\.)?(news\\.)?search\\.yahoo\\.com/", | |
| "pageElement":"id('web')/ol[last()]/li[.//div[starts-with(@class,'compText')]]|//div[@class='searchCenterMiddle']/div", | |
| "nextLink":"//div[contains(@class,'Pagination')]/a[contains(@class,'next')]", | |
| "wedata.net.id":62707 | |
| }, | |
| { | |
| "url":"^http://www\\.electricbunnycomics\\.com/View/Comic/", | |
| "pageElement":"//div[@class=\"comic_container\"]/img|//div[@class=\"comic_navbar\"][1]", | |
| "nextLink":"//a[img[@alt=\"Next\"]]", | |
| "wedata.net.id":80862 | |
| }, | |
| { | |
| "url":"^https?://bitbucket\\.org/(repo/all|.*?/commits/.*)", | |
| "pageElement":"id('repositories')/li|//table[contains(@class,'aui-table-interactive')]/tbody/tr", | |
| "nextLink":"(//ol[contains(@class,'aui-nav-pagination')]//a)[last()]", | |
| "wedata.net.id":37475 | |
| }, | |
| { | |
| "url":"^http://www\\.openthesis\\.org/search/search\\.html", | |
| "pageElement":"//div[@class='content']//tr[td]", | |
| "nextLink":"//span[@class='currentStep']/following-sibling::a", | |
| "wedata.net.id":64745 | |
| }, | |
| { | |
| "url":"^http://pc\\.watch\\.impress\\.co\\.jp/docs/column/", | |
| "pageElement":"//div[contains(concat(\" \", normalize-space(@class), \" \"), \" contents \")]", | |
| "nextLink":"//li[contains(concat(\" \", normalize-space(@class), \" \"), \" prev \")]/a", | |
| "wedata.net.id":66569 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?economist\\.com/(?:comment|node)", | |
| "pageElement":"id(\"comments\")/*", | |
| "nextLink":"//li[contains(@class,\"pager-next\")]/a", | |
| "wedata.net.id":36127 | |
| }, | |
| { | |
| "url":"^http://[^.]+\\.ap\\.teacup\\.com/[^/]+/\\d+\\.html", | |
| "pageElement":"id(\"tcmainlay\")", | |
| "nextLink":"//div[@class=\"nextpage\"]/a[last()]", | |
| "wedata.net.id":1982 | |
| }, | |
| { | |
| "url":"^http://blog\\.livedoor\\.jp/rock1963roll/archives/", | |
| "pageElement":"//div[@class=\"article-body-more\"]/*[not(@align=\"center\" or @align=\"right\")]|//div[@class=\"google-user-ad-mid\"]/preceding-sibling::*|//div[@class=\"article-header\"]|id(\"comments-list comment-form\")", | |
| "nextLink":"//a[@rel=\"prev\"]", | |
| "wedata.net.id":76910 | |
| }, | |
| { | |
| "url":"^http://thevalleyreport\\.com/\\d{4}/\\d{2}/\\d{2}/", | |
| "pageElement":"id('single')/*[not(@id='comments')]", | |
| "nextLink":"//a[@rel='prev']", | |
| "wedata.net.id":79432 | |
| }, | |
| { | |
| "url":"^http://www2192ue\\.sakura\\.ne\\.jp/~uaa/gomitext/", | |
| "pageElement":"//div[@class=\"diary\"]", | |
| "nextLink":"id(\"navbottom\")/div[@class=\"prev\"]/a", | |
| "wedata.net.id":77445 | |
| }, | |
| { | |
| "url":"^http://www\\.inside-games\\.jp/(?:article/)?imgs?/", | |
| "pageElement":"id(\"photoImage\")", | |
| "nextLink":"id(\"photo\")//div[@class=\"photoPagingNext\"]//a", | |
| "wedata.net.id":29574 | |
| }, | |
| { | |
| "url":"^http://tower\\.jp/mag/[^/]+/(?:2\\d{3}|[^/]+_back)", | |
| "pageElement":"//div[@class='containerTopMainClm']//ul[@class='inMdl-mgznBknbrList']/li", | |
| "nextLink":"//ul[@class='listModel-inlineMenuLink']/li/a[contains(@href,number(//ul[@class='listModel-inlineMenuLink']/li/strong)-1)]", | |
| "wedata.net.id":76347 | |
| }, | |
| { | |
| "url":"^http://movies\\.yahoo\\.co\\.jp/movie/\\d+/review/", | |
| "pageElement":"id('list-module')/li", | |
| "nextLink":"//a[i/@class='icon-chevron-right color-sub']", | |
| "wedata.net.id":2025 | |
| }, | |
| { | |
| "url":"^http://chikyu-no-cocolo\\.cocolog-nifty\\.com/blog", | |
| "pageElement":"//div[@class='asset-content entry-content']/*", | |
| "nextLink":"//a[@class='next page-numbers']", | |
| "wedata.net.id":65102 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?printout\\.jp/clipart/clipart_d/", | |
| "pageElement":"//table[@bgcolor='#EFEFEF' or @bgcolor='#efefef' or @class='fontb']/following-sibling::div[@align='center']/table[not(@bgcolor='#EFEFEF')]|id('container100x100')", | |
| "nextLink":"//td[.//a[contains(@href,\"index.html\") or @href=\"/clipart/\"]]/following-sibling::td[last()]/a", | |
| "wedata.net.id":77184 | |
| }, | |
| { | |
| "url":"^http://www\\.mugendoweb\\.jp/t_tsuge/view\\.files/", | |
| "pageElement":"//a[1][not(./following-sibling::a[@href=\"http://www.mugendo-web.com/t_tsuge/view.htm\"])]/preceding-sibling::img|//a[@href=\"http://www.mugendo-web.com/t_tsuge/view.htm\"]/preceding-sibling::*", | |
| "nextLink":"//a[last()][.//img]|//a[@href=\"uranisi01.htm\"]", | |
| "wedata.net.id":77341 | |
| }, | |
| { | |
| "url":"^http://www\\.lib\\.city\\.bunkyo\\.tokyo\\.jp/opw/", | |
| "pageElement":"//table[@rules=\"none\"]//tr[./td]", | |
| "nextLink":"//tr[@align=\"center\"]/td[./nobr][last()-1]//a", | |
| "wedata.net.id":64890 | |
| }, | |
| { | |
| "url":"^http://(?:browse|members|forum)\\.minitokyo\\.net/", | |
| "pageElement":"id('content')/ul/li|id('members posts')//*[td and @class or self::dd]", | |
| "nextLink":"//a[.='Next »']", | |
| "wedata.net.id":59016 | |
| }, | |
| { | |
| "url":"^http://portal\\.nifty\\.com/special\\d+/\\d+/\\d+/", | |
| "insertBefore":"//td[@width=\"540\" and @align=\"center\"]/ancestor::table[last()]/following-sibling::node()[1]", | |
| "pageElement":"//td[@width=\"540\" and @align=\"center\"]/ancestor::table[last()]", | |
| "nextLink":"//td[@width=\"540\" and @align=\"center\"]//a[contains(string(.),\"\uff1e\")]", | |
| "wedata.net.id":26661 | |
| }, | |
| { | |
| "url":"^http://news\\.livedoor\\.com/article/image_detail/", | |
| "pageElement":"//figure[@class='imageFigure']", | |
| "nextLink":"//li[@class='imagePagerNext']/a", | |
| "wedata.net.id":29655 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?public-domain-photos\\.com/[^/]+", | |
| "pageElement":"id(\"right\")/div[@class=\"gallery\"]", | |
| "nextLink":"(//div[contains(concat(\" \", @class, \" \"), \" navigation \")]/a[last()])[last()]", | |
| "wedata.net.id":1623 | |
| }, | |
| { | |
| "url":"^http://www\\.irisplaza\\.co\\.jp/Index\\.asp\\?KB=", | |
| "pageElement":"id('itembox2013')/li", | |
| "nextLink":"//li[@class='ya_next']/a", | |
| "wedata.net.id":29664 | |
| }, | |
| { | |
| "url":"^http://www\\.neowing\\.co\\.jp/newrelease/[^/]+/.*", | |
| "pageElement":"//div[@class='our_price']/following-sibling::div//tr", | |
| "nextLink":"//a[.='>次のページ']", | |
| "wedata.net.id":61039 | |
| }, | |
| { | |
| "url":"^http://mplus-fonts\\.osdn\\.jp/cgi-bin/blosxom.cgi", | |
| "pageElement":"id('title')/following-sibling::*[following-sibling::div/@id='more']", | |
| "nextLink":"id('more')/a", | |
| "wedata.net.id":1648 | |
| }, | |
| { | |
| "url":"^http://www\\.oricon\\.co\\.jp/rank/\\w{2,3}/[dwy]/", | |
| "pageElement":"id(\"content-main\")//article/section", | |
| "nextLink":"id(\"content-main\")//article/div/ul/li[a/@class=\"is-active\"]/following-sibling::li/a", | |
| "wedata.net.id":55595 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?smileycat\\.com/design_elements/", | |
| "pageElement":"//div[@class=\"gradient\"]", | |
| "nextLink":"//p[@class=\"paginate\"]/a[contains(., \"Next\")]", | |
| "wedata.net.id":1496 | |
| }, | |
| { | |
| "url":"^http://0451089\\.jp/[^/]+/(?:search|feature)\\.php", | |
| "insertBefore":"//div[contains(@class, \"num_range_index\")][last()]", | |
| "pageElement":"//div[@class='details']", | |
| "nextLink":"//a[@title='次へ']", | |
| "wedata.net.id":41769 | |
| }, | |
| { | |
| "url":"^http://us\\.yhs4\\.search\\.yahoo\\.com/yhs/search", | |
| "pageElement":"id(\"web\")/ol", | |
| "nextLink":"id(\"pg-next\")", | |
| "wedata.net.id":2169 | |
| }, | |
| { | |
| "url":"^http://www\\.ravco\\.jp/cat/view\\.php\\?cat_id=.+", | |
| "pageElement":"//div[@class='title clear']|id('content')", | |
| "nextLink":"id('content')/p[last()]/a[contains(.,'次の事項')]", | |
| "wedata.net.id":76737 | |
| }, | |
| { | |
| "url":"^http://saneiinternationalgroup-officialblog\\.com/", | |
| "pageElement":"//div[@class=\"post\" or @class=\"article\"]", | |
| "nextLink":"//link[@rel=\"prev\"] | id(\"nav_next\")/a", | |
| "wedata.net.id":64144 | |
| }, | |
| { | |
| "url":"http://www.myfreecams.com/php/exclusive_gallery.php", | |
| "pageElement":"//a[@href=\"exclusive_gallery.php\"]/following-sibling::div[@onmousedown]", | |
| "nextLink":"//a[@href=\"exclusive_gallery.php\"]/following-sibling::b[1]/following-sibling::a[1]", | |
| "wedata.net.id":77741 | |
| }, | |
| { | |
| "url":"^https?://(?:www\\.)?hcs64\\.com/mboard/forum\\.php", | |
| "pageElement":"//table[@class='threadlist']//tr[.//@class='subject']|//dl[@class='postlist']", | |
| "nextLink":"//a[.='Next Page']", | |
| "wedata.net.id":74664 | |
| }, | |
| { | |
| "url":"^http://(?:search|www)\\.channelregister\\.co\\.uk/", | |
| "pageElement":"//div[@class='headlines']/section", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":28949 | |
| }, | |
| { | |
| "url":"^http://(?:blog\\.excite\\.co|[^.]+\\.exblog)\\.jp/", | |
| "pageElement":"//div[@class=\"pagerNavLink\"]/preceding-sibling::*", | |
| "nextLink":"//span[@class=\"nextpage\"]/a", | |
| "wedata.net.id":1491 | |
| }, | |
| { | |
| "url":"^http://.+\\.usnews\\.(?:rankingsandreviews\\.)?com", | |
| "pageElement":"//div[@id='article']/div[contains(@class,'-odd') or contains(@class,'-even') or contains(@class,'-solid')] | //div[@id='article' or @class='wide']/table/tbody", | |
| "nextLink":"id('pagination')/span/following-sibling::a[1]", | |
| "wedata.net.id":73957 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?utamap\\.com/searchkasi\\.php\\?", | |
| "pageElement":"//table[@bgcolor='#009999']//tr[td]", | |
| "nextLink":"//a[contains(.,'>>>')][last()]", | |
| "wedata.net.id":695 | |
| }, | |
| { | |
| "url":"^http://special\\.nikkeibp\\.co\\.jp/(atclh/|\\?bn)", | |
| "pageElement":"//div[@class='honbun']/*|//div[@class='innerBox']/ul", | |
| "nextLink":"//div[@class='next']/a", | |
| "wedata.net.id":77601 | |
| }, | |
| { | |
| "url":"^http://3rd\\.geocities\\.jp/colony_drops/oishinba.", | |
| "pageElement":"//pre", | |
| "nextLink":"//pre/a[starts-with(.,'next')]", | |
| "wedata.net.id":41251 | |
| }, | |
| { | |
| "url":"^http://drmfree\\.calibre-ebook\\.com/(?:by|newest)", | |
| "pageElement":"id('object_list')/li", | |
| "nextLink":"//span[@class='pagination_page_number'][not(a)]/following-sibling::span[1]/a", | |
| "wedata.net.id":53522 | |
| }, | |
| { | |
| "url":"^http://www\\.comic-ryu\\.jp/(?:book|web_content)s/", | |
| "pageElement":"//div[@class='block plain framed']|//table[@class='table']", | |
| "nextLink":"//a[contains(img/@src,'_wht_Right.gif')]", | |
| "wedata.net.id":57493 | |
| }, | |
| { | |
| "url":"^http://www\\.bishojobunko\\.jp/c/novels/novel/act/", | |
| "pageElement":"id(\"t_RIGHTSIDE\")/div[@class=\"dropcap\"]", | |
| "nextLink":"//p[a[@class=\"nextpage\"]]/text()[string-length(normalize-space(.))>1]/following-sibling::a|id(\"t_LEFTSIDE\")[not(//p[a[@class=\"nextpage\"]]/text()[string-length(normalize-space(.))>1]/following-sibling::a)]//ul[@class=\"t_linklist4\"]/li[p]/following-sibling::li/a", | |
| "wedata.net.id":64153 | |
| }, | |
| { | |
| "url":"^http://www\\.pastemagazine\\.com/(articles|search)", | |
| "pageElement":"//ul[@class='nof tagged-articles-list' or @class='nof search-articles-list']/li", | |
| "nextLink":"//a[@class='non next']", | |
| "wedata.net.id":80696 | |
| }, | |
| { | |
| "url":"^http://money\\.minkabu\\.jp/(author|category|\\d+)", | |
| "pageElement":"//div[contains(@class,'pagination')]/preceding-sibling::div[1]/*", | |
| "nextLink":"//a[@class='page_next' or ../@class='nextprev']", | |
| "wedata.net.id":74395 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?motordays\\.com/newcar/articles/", | |
| "pageElement":"//div[@class=\"entry\"]|//div[@class=\"paginate\"]/following-sibling::ul/li|//div[@class=\"paginate\"]/following-sibling::div[@class=\"clearblock\"][./following-sibling::div[@class=\"paginate\"]]", | |
| "nextLink":"id(\"maincontents\")//a[contains(@class,\"nextpage\")]", | |
| "wedata.net.id":28764 | |
| }, | |
| { | |
| "url":"^http://(?:[^.]+\\.)?thinkexist\\.com/quotes/[^/]+/", | |
| "pageElement":"//div[table/descendant::td[@class=\"sqtdq\"]]", | |
| "nextLink":"//a[img[contains(@src,\"paging/next.gif\")]]", | |
| "wedata.net.id":2764 | |
| }, | |
| { | |
| "url":"^http://www\\.fashionsnap\\.com/(streetsnap|inside)", | |
| "pageElement":"(id('block')|//ul[@class='list'])/li", | |
| "nextLink":"//a[@class='link_next' or @class='next']", | |
| "wedata.net.id":2607 | |
| }, | |
| { | |
| "url":"^http://www5b\\.biglobe\\.ne\\.jp/~hilihili/keitou/", | |
| "pageElement":"//blockquote/center[last()]/following-sibling::p[text()][following-sibling::p[contains(a,'←') or contains(a,'→')][4]]", | |
| "nextLink":"//blockquote//a[contains(.,'進')]", | |
| "wedata.net.id":74370 | |
| }, | |
| { | |
| "url":"^http://serif\\.hatelabo\\.jp/serif_generator/image", | |
| "pageElement":"//ul[@class='image-list']/li", | |
| "nextLink":"//a[@class='pager-next']", | |
| "wedata.net.id":1413 | |
| }, | |
| { | |
| "url":"^http://oku\\.edu\\.mie-u\\.ac\\.jp/~okumura/blog/", | |
| "pageElement":"id(\"main\")/div[contains(concat(\" \", @class, \" \"), \" node \")]", | |
| "nextLink":"//li[contains(concat(\" \", @class, \" \"), \" pager-next \")]/a", | |
| "wedata.net.id":42142 | |
| }, | |
| { | |
| "url":"^https?://webnewtype\\.com/(?:column|news|report)/", | |
| "pageElement":"//div[@class=\"prevAfterBox\"]/preceding-sibling::*|//div[./div[@class=\"related_imgArea\"]]/preceding-sibling::*[not(//div[@class=\"prevAfterBox\"])]", | |
| "nextLink":"//div[@class=\"related_imgArea\"]/ul/li/a|//li[@class=\"after\"]/a", | |
| "wedata.net.id":77042 | |
| }, | |
| { | |
| "url":"^http://(?:[^./]+\\.)?blog\\.respekt\\.ihned\\.cz/", | |
| "pageElement":"//article", | |
| "nextLink":"//a[@class='a-next']", | |
| "wedata.net.id":55964 | |
| }, | |
| { | |
| "url":"^https?://www\\.computerworld\\.jp/(?:topic|new)s/", | |
| "pageElement":"//p[@class=\"time\"]/following-sibling::*[not(p[@class=\"pagenp\"]) and not(@class=\"acolumn\") and (following::self[@class=\"acolumn\"] or following::p[@class=\"pagenp\"])]", | |
| "nextLink":"id(\"article\")/div[@class=\"boxadd\"]/p/*/following-sibling::a[contains(text(), \"\u6b21\u306e\u30da\u30fc\u30b8\u3078\")]", | |
| "wedata.net.id":1753 | |
| }, | |
| { | |
| "url":"^http://(?:beta\\.)?nantokadoga\\.com/search\\.php", | |
| "pageElement":"id(\"main_area\")/div[contains(@class, \"movie_block\")]", | |
| "nextLink":"//div[@class=\"paging\"]/a[not(following-sibling::a)]", | |
| "wedata.net.id":697 | |
| }, | |
| { | |
| "url":"^https://support\\.microsoft\\.com/[^/]+/search\\?", | |
| "pageElement":"//div[@class='ng-scope ng-isolate-scope']", | |
| "nextLink":"id('pagination-next')", | |
| "wedata.net.id":32500 | |
| }, | |
| { | |
| "url":"^http://www\\.computerbild\\.de/(?:artikel|suche)/", | |
| "pageElement":"//div[contains(concat(\" \", @class, \" \"), \" paragraph \")]/node()|id(\"searchListNarrow\")/*", | |
| "nextLink":"//div[@class=\"next\"]/a", | |
| "wedata.net.id":32505 | |
| }, | |
| { | |
| "url":"^http://(www\\.)?mai-net\\.(net|ath\\.cx)/bbs/sst/", | |
| "pageElement":"//tr[td/@class='bgc']", | |
| "nextLink":"//table[@class='brdr']//a[contains(., '次を表示する')]", | |
| "wedata.net.id":36225 | |
| }, | |
| { | |
| "url":"^http://www\\.dmm\\.com/netgame/community/-/topic/", | |
| "pageElement":"//div[contains(@class,'ntg-comment-list')]/ul/li", | |
| "nextLink":"//ul[@class='area-pager']/li[span]/following-sibling::li/a", | |
| "wedata.net.id":76461 | |
| }, | |
| { | |
| "url":"^http://comichitokui\\.web\\.fc2\\.com/\\d+\\.html", | |
| "pageElement":"//div[@id=\"main\"]", | |
| "nextLink":"//div/a[contains(text(),\"\u6b21\u306e\u30da\u30fc\u30b8\")]", | |
| "wedata.net.id":39772 | |
| }, | |
| { | |
| "url":"^https?://(www|editorial)\\.rottentomatoes\\.com/.", | |
| "pageElement":"//table[@class='table table-striped']/tbody/tr|//div[@class='row ' or @class='row review_table_row']", | |
| "nextLink":"//a[span/@class='glyphicon glyphicon-chevron-right']|//*[@class='pull-right']/a[count(//*[@class='pull-right']/a)=4 or number(substring-after(//*[@class='pull-right']/a/@href,'&page='))=2 or contains(@class,'pagination-next-link')]", | |
| "wedata.net.id":76452 | |
| }, | |
| { | |
| "url":"^http://www\\.keezmovies\\.com/pornstar(?:[?/#]|$)", | |
| "pageElement":"id(\"actorFilterContainer\")", | |
| "nextLink":"id(\"paginator_next\")/a", | |
| "wedata.net.id":55967 | |
| }, | |
| { | |
| "url":"^http://www\\.geocities\\.jp/studio_cabana/c/\\w+/", | |
| "pageElement":"//center/*[1]", | |
| "nextLink":"//a[img[not(@alt) or starts-with(@alt, \"ep\")]]", | |
| "wedata.net.id":40781 | |
| }, | |
| { | |
| "url":"^http://horinlovebooks\\.com/\\?mode=(?:grp|cate)&", | |
| "pageElement":"//div[@class=\"main\"]/center/*[self::div or self::br[@style]]", | |
| "nextLink":"//a[normalize-space()='次のページへ']", | |
| "wedata.net.id":77728 | |
| }, | |
| { | |
| "url":"^http://www\\.s-manga\\.net/cgi-bin/s-search\\.cgi", | |
| "pageElement":"//div[@class='schcell']", | |
| "nextLink":"//li[@class='paging-next']/a", | |
| "wedata.net.id":77732 | |
| }, | |
| { | |
| "url":"^https?://ax\\.ofthemall\\.com/products/list\\.php", | |
| "pageElement":"//form[starts-with(@name, \"product_form\")]", | |
| "nextLink":"//a[contains(text(), \"次へ\")]", | |
| "wedata.net.id":61951 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?hirosegawa-net\\.com/interview/", | |
| "pageElement":"//div[@class=\"title_n\"][img]/preceding-sibling::*[1]/following-sibling::node()|//td[img and table]/table/tbody/tr", | |
| "nextLink":"//img[not(contains(@alt, \"\u76ee\u6b21\")) and (contains(@alt, \"\u6b21\") or contains(@alt, \"\u8a71\") or contains(@src,\"next\"))]/parent::a", | |
| "wedata.net.id":53202 | |
| }, | |
| { | |
| "url":"^https://www\\.imf\\.org/external/what/what\\.aspx", | |
| "pageElement":"id(\"content-main\")/div", | |
| "nextLink":"//ul[@class=\"archive\"]//a[last()]", | |
| "wedata.net.id":76427 | |
| }, | |
| { | |
| "url":"^http://www\\.digicafe\\.jp/php/mail_history\\.php", | |
| "pageElement":"id(\"main\")", | |
| "nextLink":"//div[@class=\"pager\"]/a[@title=\"next page\"]", | |
| "wedata.net.id":33380 | |
| }, | |
| { | |
| "url":"^http://goethe\\.nikkei\\.co\\.jp/fashion/catalog/", | |
| "pageElement":"//div[@class=\"fashion_contents\"]", | |
| "nextLink":"id(\"page_but_next\")/a", | |
| "wedata.net.id":39543 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?dominic-deegan\\.com/view\\.php", | |
| "pageElement":"//div[@class=\"comic\"]", | |
| "nextLink":"id(\"bottom\")//li/a[img[@alt=\"Next\"]]", | |
| "wedata.net.id":31638 | |
| }, | |
| { | |
| "url":"^http://themodzoo\\.com/forum/page/articles\\.html", | |
| "pageElement":"//p[@class='bbc_center']", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":76804 | |
| }, | |
| { | |
| "url":"^http://(www|forums)\\.hardwarezone\\.com(\\.sg)?/", | |
| "pageElement":"//div[@class='page' or @class='post ']", | |
| "nextLink":"//li[@class='prevnext next' or @class='next' or starts-with(a/@title,'Next Page')]/a", | |
| "wedata.net.id":485 | |
| }, | |
| { | |
| "url":"^https?://(search|www)\\.microsoft\\.com/.+/search", | |
| "pageElement":"//div[starts-with(@class,'row-fluid')][div[contains(@class,'result_container') or @class='cutting_line']]", | |
| "nextLink":"//a[@title='next page' or span/@class='next-page']", | |
| "wedata.net.id":2688 | |
| }, | |
| { | |
| "url":"^https?://www\\.switch-science\\.com/catalog/list/", | |
| "pageElement":"id('products')/ul/li", | |
| "nextLink":"id('pagination')/p/a[contains(.,'>>')]", | |
| "wedata.net.id":74948 | |
| }, | |
| { | |
| "url":"^http://www\\.amazon\\.co\\.jp/gp/cart/view\\.html", | |
| "pageElement":"id(\"cart-saved-items cart-active-items\")", | |
| "nextLink":"//div[@class=\"cart-item-pagination\"]/a[number(parent::div/@page)+1]", | |
| "wedata.net.id":56662 | |
| }, | |
| { | |
| "url":"^https://shinkansen\\.travel/tokyobookmark/search/", | |
| "pageElement":"//div[@class='plan-sort-child']", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":45677 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?big-men\\.net/face/joyful\\.cgi", | |
| "pageElement":"//center", | |
| "nextLink":"//td/b/following-sibling::a[1]", | |
| "wedata.net.id":27448 | |
| }, | |
| { | |
| "url":"^https?://www\\.instapaper\\.com/(u|liked|archive)", | |
| "pageElement":"//div[@id=\"article_list\"]/div[@class=\"articles\"]", | |
| "nextLink":"//div[@class=\"pagination group\"]/a", | |
| "wedata.net.id":2124 | |
| }, | |
| { | |
| "url":"^http://www\\.nikkeibp\\.co\\.jp/style/secondstage", | |
| "pageElement":"//tr[./td/img[@src=\"img/bn_line.gif\"]][1]/following-sibling::tr[following-sibling::tr[./td/img[@src=\"img/bn_line.gif\"]]]|//tr[./td/img[@src=\"img/bn_line.gif\"]][1]|//font[@color=\"#333333\"][.//strong][./text()]", | |
| "nextLink":"//a[./img[@src=\"img/old.gif\"]]", | |
| "wedata.net.id":746 | |
| }, | |
| { | |
| "url":"^http://(?:www|blog)\\.gsmarena\\.com\\/.*\\.php3$", | |
| "pageElement":"//div[@class=\"floating-title\"]/*|//div[@class=\"post\"]", | |
| "nextLink":"//a[contains(@class,\"next\")]", | |
| "wedata.net.id":73876 | |
| }, | |
| { | |
| "url":"^http://t17\\.techbang\\.com/(?:topics|categories)", | |
| "pageElement":"id('new_comment')/*[@id or self::hr] | id('new_topic')//tr", | |
| "nextLink":"//a[@rel=\"next\"][last()]", | |
| "wedata.net.id":52003 | |
| }, | |
| { | |
| "url":"^http://news\\.mynavi\\.jp/series/(horror|mousou)/", | |
| "pageElement":"//p[@class=\"lyt-hdg-03-03\"]|(//div[contains(@class,\"center\")][not(.//img[contains(@src,\"images/001.jpg\")])]|//div[contains(@class,\"center\")][not(.//img[contains(@src,\"images/001.jpg\")])]/following-sibling::*[self::p or self::h3]|//div[contains(@class,\"center\")][not(.//img[contains(@src,\"images/001.jpg\")])]/preceding-sibling::*[self::p or self::h3])[not(//p[@class=\"banner\"])]|(//div[contains(@class,\"center\")]|//div[contains(@class,\"center\")]/preceding-sibling::*[self::p or self::h3]|//div[contains(@class,\"center\")]/following-sibling::*[self::p or self::h3])[//p[@class=\"banner\"]]", | |
| "nextLink":"//link[@rel=\"next\"]", | |
| "wedata.net.id":80856 | |
| }, | |
| { | |
| "url":"^https?://www\\.daijob\\.com/jobs/(search|joblist)", | |
| "pageElement":"//div[@class='jobs_box mb16']", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":38904 | |
| }, | |
| { | |
| "url":"^https?://www.spoofcard.com/account/calls/history/", | |
| "pageElement":".//*[@id='main']/div", | |
| "nextLink":".//*[@id='pagination']/a[2]", | |
| "wedata.net.id":77335 | |
| }, | |
| { | |
| "url":"^https?://gihyo\\.jp/[^/]+/(?:clip|feature|serial)", | |
| "pageElement":"id('primary')//div[contains(concat(' ', @class, ' '), ' readingContent01 ')][id('article')]|//ul[@class='articleList01' or @class='toc article']//li|//h2[@class='subTitle01'][number(substring-after(id('primary')//li[@class='current']/a/@href,'?page='))=1 or not(//div[contains(@class,'pageSwitch01')])]|//p[@class='date' or @class='author'][number(substring-after(id('primary')//li[@class='current']/a/@href,'?page='))=1 or not(//div[contains(@class,'pageSwitch01')])]", | |
| "nextLink":"id('primary')//p[@class='next']/a[last()]|//ul[@class='linkList02']/li[@class='here']/preceding-sibling::li[1]/a", | |
| "wedata.net.id":26648 | |
| }, | |
| { | |
| "url":"^http://www\\.gamespark\\.jp/(?:article|category)/", | |
| "pageElement":"id('articlePaging')/preceding-sibling::node()[not(@id='nextPageButton')]|//ul[@class='newsItem' or @class='comment-list']/li[not(id('articleItem'))]", | |
| "nextLink":"id('nextPageButton')|//li[@class='next']/a", | |
| "wedata.net.id":70183 | |
| }, | |
| { | |
| "url":"^http://www\\.network54\\.com/Forum/47210/thread/.", | |
| "pageElement":"//center/table[@width=\"94%\"]", | |
| "nextLink":"//a[text()=\"<< Previous Topic\"]", | |
| "wedata.net.id":29272 | |
| }, | |
| { | |
| "url":"^http://allabout\\.co\\.jp/recipe/search/material/", | |
| "pageElement":"//ul[@class=\"aa_media-list\"]", | |
| "nextLink":"//a[(text()=\"次のページへ\")]", | |
| "wedata.net.id":77845 | |
| }, | |
| { | |
| "url":"^http://d\\.hatena\\.ne\\.jp/[-\\w]+/archivemobile", | |
| "pageElement":"//dl[@class='archives']/*", | |
| "nextLink":"id('pager-bottom')/a[@accesskey='6']", | |
| "wedata.net.id":55516 | |
| }, | |
| { | |
| "url":"^http://whisper\\.wisdom-guild\\.net/search\\.php?", | |
| "pageElement":"//div[@class=\"card\"]", | |
| "nextLink":"//a[contains(text(),'次へ')]", | |
| "wedata.net.id":61019 | |
| }, | |
| { | |
| "url":"^http://kindai\\.ndl\\.go\\.jp/search/searchResult", | |
| "pageElement":"id('search-result-list')//tr", | |
| "nextLink":"//li[@class='paging-next']/a", | |
| "wedata.net.id":70147 | |
| }, | |
| { | |
| "url":"^http://itpro\\.nikkeibp\\.co\\.jp/(.+)?[aA]ctive/", | |
| "pageElement":"id('articleBody')/*|id('newArrival')/h2/following-sibling::node()|//div[@class=\"contentBox\"]/ul/li", | |
| "nextLink":"//span[@class='next']/a|//p[@class='toNextPage' or @class='more']/a|//div[@class='pageNation']/a[last()][count(//div[@class='pageNation']/a)>1][not(@class='toMokuji')]", | |
| "wedata.net.id":62675 | |
| }, | |
| { | |
| "url":"^http://www\\.bs-garden\\.com/(?:system|drama_cd)/", | |
| "pageElement":"id('list')/ul/li|id('next_page')/following-sibling::*", | |
| "nextLink":"id('btm next_page')/ul/li[child::a[not(@href)]]/following-sibling::li[1]/a", | |
| "wedata.net.id":63185 | |
| }, | |
| { | |
| "url":"^http://www\\.fileformat\\.info/info/unicode/char/", | |
| "pageElement":"//div[@class='span12 boxshadow']", | |
| "nextLink":"//a[contains(img/@src,'vcrforward.png')]", | |
| "wedata.net.id":27180 | |
| }, | |
| { | |
| "url":"^http://www\\.mhi\\.co\\.jp/discover/story/project", | |
| "pageElement":"id('storyProjectBody')", | |
| "nextLink":"//div[@class='page']/a[contains(img/@src,'next')]", | |
| "wedata.net.id":63589 | |
| }, | |
| { | |
| "url":"^http://members\\.stvnet\\.home\\.ne\\.jp/naoki12/", | |
| "pageElement":"//p", | |
| "nextLink":"//p/a[img or preceding-sibling::br]", | |
| "wedata.net.id":54852 | |
| }, | |
| { | |
| "url":"^http://(www\\.)?jpdo\\.com/sks9/\\d+/joyful\\.cgi", | |
| "pageElement":"//p[table/@class='thread']", | |
| "nextLink":"//form[@action='joyful.cgi']//b/following-sibling::a[1]", | |
| "wedata.net.id":62725 | |
| }, | |
| { | |
| "url":"^http://sea-mew\\.jp/nox/modules/webarc/2ch/[^/]+/", | |
| "pageElement":"//div[contains(@class,\"trivial\")]", | |
| "nextLink":"//a[contains(text(),\"次へ\")]", | |
| "wedata.net.id":27145 | |
| }, | |
| { | |
| "url":"^http://bn\\.merumo\\.ne\\.jp/backno/listView\\.do", | |
| "pageElement":"//div[@class=\"bn_content\"]/div[@class=\"bn_content_text\"]", | |
| "nextLink":"//div[@class=\"bn_content\"]/ul[@class=\"bn_navi\"]/li[@class=\"next\"]/a", | |
| "wedata.net.id":33265 | |
| }, | |
| { | |
| "url":"https://bugs\\.chromium\\.org/p/.+?/issues/list.*", | |
| "pageElement":"id('resultstable')", | |
| "nextLink":"//div[@class='pagination'][count(./a)>1 or ./a/preceding-sibling::text()[string-length(.)>2]]/a[last()]", | |
| "wedata.net.id":80955 | |
| }, | |
| { | |
| "url":"^http://www\\.fantasistadoll\\.com/special/novel/", | |
| "pageElement":"//div[@class='TextBox']/p/node()", | |
| "nextLink":"//li[@class='Current']/following-sibling::li/a", | |
| "wedata.net.id":74369 | |
| }, | |
| { | |
| "url":"^http://www\\.theverge\\.com/(?:tag|.*?/archives)", | |
| "pageElement":"//ul[contains(@class,'p-basic-article-list')]/li", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":74407 | |
| }, | |
| { | |
| "url":"^http://www1\\.axfc\\.net/uploader/search\\.pl\\?", | |
| "pageElement":"//table[@class='lst']//tr[td]", | |
| "nextLink":"id('main')/p/a[.='Next']", | |
| "wedata.net.id":29282 | |
| }, | |
| { | |
| "url":"^http://www\\.theregister\\.co\\.uk/(?:\\d+/){3}.", | |
| "pageElement":"id(\"body\")/*", | |
| "nextLink":"id(\"page-nav\")/ul/li[last()]/a", | |
| "wedata.net.id":2769 | |
| }, | |
| { | |
| "url":"^http://morningmanga\\.com/(?:[^/]+/list|search/)", | |
| "pageElement":"id(\"main\")/*[@class=\"article-list\" or @class=\"comics-list\" or @class=\"pager\"]/dl", | |
| "nextLink":"//a[../@class=\"next\" or @title=\"もっと見る\"]", | |
| "wedata.net.id":64908 | |
| }, | |
| { | |
| "url":"^http://www\\.bible\\.or\\.jp/search/search\\.cgi", | |
| "pageElement":"//ol", | |
| "nextLink":"//td[@align=\"right\"]/a[contains(@href,\"pre_next=next\")][./img]", | |
| "wedata.net.id":1910 | |
| }, | |
| { | |
| "url":"^http://news\\.nicovideo\\.jp/(media/article|tag)", | |
| "pageElement":"//ul[@class=\"index\"]/li", | |
| "nextLink":"//li[@class=\"page-navigator-next\"]/a", | |
| "wedata.net.id":60835 | |
| }, | |
| { | |
| "url":"^http://www\\.cosmicpub\\.com/products/list\\.php", | |
| "pageElement":"//div[contains(concat(' ', @class, ' '), ' product_list ')]/form", | |
| "nextLink":"//div[contains(concat(' ', @class, ' '), ' navi ')]/a[normalize-space()='次へ>>']", | |
| "wedata.net.id":77734 | |
| }, | |
| { | |
| "url":"^http://www\\.spoj\\.com/(?:problem|rank|statu)s/", | |
| "pageElement":"id('content')//table//tr[./td]", | |
| "nextLink":"//ul[@class=\"pagination\"]/li[last()-1]/a", | |
| "wedata.net.id":29367 | |
| }, | |
| { | |
| "url":"^http://forums\\.animesuki\\.com/(member|archive)", | |
| "pageElement":"id('message_list')/li|id('pagenumbers')/following-sibling::*[following-sibling::div/@id='copyright']", | |
| "nextLink":"//a[@rel='next']|id('pagenumbers')/b[2]/following-sibling::a", | |
| "wedata.net.id":26725 | |
| }, | |
| { | |
| "url":"^http://www\\.flickr\\.com/photos/[^/]+/tags/[^/]", | |
| "pageElement":"id(\"Tertiary\")/following-sibling::table[position()=1]", | |
| "nextLink":"id(\"paginator-module\")/descendant::a[contains(concat(\" \", @class, \" \"), \" Next \")]", | |
| "wedata.net.id":463 | |
| }, | |
| { | |
| "url":"^https://www\\.encrest\\.jp/search/list\\.html\\?", | |
| "pageElement":"//div[@class='article']", | |
| "nextLink":"id('next')/div/span/following-sibling::a[1]", | |
| "wedata.net.id":38344 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?pandora\\.nu/summer/u18novels/", | |
| "pageElement":"//table[@bgcolor=\"#0000cf\"]/preceding-sibling::node()[not(@align=\"center\")]", | |
| "nextLink":"//td[@align=\"right\"]/a[./small]", | |
| "wedata.net.id":57804 | |
| }, | |
| { | |
| "url":"^http://www\\.wowow\\.co\\.jp/sports/nba/columns/", | |
| "pageElement":"//div[@class=\"interview_detail clearfix\"]/p", | |
| "nextLink":"//div[@class=\"next_p\"]/a", | |
| "wedata.net.id":65585 | |
| }, | |
| { | |
| "url":"^http://(?:apod|antwrp\\.gsfc)\\.nasa\\.gov/apod/", | |
| "pageElement":"//center[not(script)] | //center[not(script)]/following-sibling::p", | |
| "nextLink":"//a[contains(text(), \"<\")]", | |
| "wedata.net.id":29838 | |
| }, | |
| { | |
| "url":"^http://backnumber\\.dailynews\\.yahoo\\.co\\.jp/", | |
| "pageElement":"//small[contains(text(),\"\u4ef6\")]/../../../../../../..|//form[@name=\"download\"]/following-sibling::node()", | |
| "nextLink":"//a[contains(text(),\"\u6b21\")]|//strong[contains(text(),\"\u524d\")]/../../a", | |
| "wedata.net.id":2355 | |
| }, | |
| { | |
| "url":"^http://news\\.denfaminicogamer\\.jp/projectbook/", | |
| "pageElement":"//div[@class=\"top-pagelink\"]/following-sibling::*[following-sibling::div[@class=\"next_page_header\" or @class=\"relate-article\"]]", | |
| "nextLink":"//div[@class='page-num']/span/following-sibling::a", | |
| "wedata.net.id":77855 | |
| }, | |
| { | |
| "url":"^http://www\\.geocities\\.co\\.jp/Athlete-Athene/", | |
| "pageElement":"id(\"top\")/following-sibling::node()", | |
| "nextLink":"//td/a[contains(text(), substring(string(id(\"top2\")),1,4)+1)]", | |
| "wedata.net.id":52517 | |
| }, | |
| { | |
| "url":"^http://blog\\.esuteru\\.com/archives/\\d+\\.html", | |
| "pageElement":"id(\"entry\")/section[contains(concat(\" \", @class, \" \"), \" head \")]|id(\"entry\")/div[contains(concat(\" \", @class, \" \"), \" body \")]|id(\"wrapper\")//div[contains(concat(\" \", @class, \" \"), \" article_detail_area \")]", | |
| "nextLink":"//a[@href][contains(concat(\" \", @class, \" \"), \" next \")]|//a[@href][contains(concat(\" \", @class, \" \"), \" next_prev_article_area right \")]", | |
| "wedata.net.id":55354 | |
| }, | |
| { | |
| "url":"^http://blog\\.jquery\\.com/\\d{4}/\\d{2}/\\d{2}/", | |
| "pageElement":"id('content')/*[not(@class='pagination')]", | |
| "nextLink":"//link[@rel='prev']", | |
| "wedata.net.id":31251 | |
| }, | |
| { | |
| "url":"^https://docs\\.python\\.org/dev/[a-z]+/.+\\.html", | |
| "pageElement":"//div[@class='bodywrapper']", | |
| "nextLink":"//a[@accesskey='N']", | |
| "wedata.net.id":672 | |
| }, | |
| { | |
| "url":"^http://sellinglist\\.auctions\\.yahoo\\.co\\.jp/", | |
| "pageElement":"//tr[@class='pi']", | |
| "nextLink":"//p[@class='next']/a", | |
| "wedata.net.id":55853 | |
| }, | |
| { | |
| "url":"^https?://item\\.rakuten\\.co\\.jp/(?:[^/]+/)+?c/", | |
| "pageElement":"id(\"risFil\")/table[@vspace]//tr", | |
| "nextLink":"//p[@class=\"risfAllPages\"][count(./a)=2 or //link[@rel=\"canonical\"][not(contains(@href,\"?p=\"))]]/a[last()]", | |
| "wedata.net.id":28758 | |
| }, | |
| { | |
| "url":"^http://tatsuhisasuzuki\\.sakura\\.ne\\.jp/diary/", | |
| "pageElement":"//div[@class=\"post\"]", | |
| "nextLink":"//a[contains(text(), \"Previous Entries\")] | //link[@rel=\"prev\"]", | |
| "wedata.net.id":64148 | |
| }, | |
| { | |
| "url":"met-art\\.com/members/(movies|model/.+?/gallery)/", | |
| "pageElement":"//table[@class=\"gallery_table\"]", | |
| "nextLink":"//td[@class=\"next_page\"]/a", | |
| "wedata.net.id":36035 | |
| }, | |
| { | |
| "url":"^http://(?:[^.]+\\.)?avfantasy\\.com/[^.]+\\.aspx", | |
| "pageElement":"id(\"RightSideHolder\")/table/tbody/tr", | |
| "nextLink":"//a[@class=\"CurrentPageCss\"]/following-sibling::a[1]", | |
| "wedata.net.id":25674 | |
| }, | |
| { | |
| "url":"^http://www\\.sinsai\\.info/(index\\.php|reports)", | |
| "pageElement":"//div[@class='report_row1' or @class='rb_report']", | |
| "nextLink":"//ul[@class='pager']/li[a/@class='active']/following-sibling::li[1]/a", | |
| "wedata.net.id":47941 | |
| }, | |
| { | |
| "url":"^http://www\\.penyards\\.com/SearchResults\\.aspx", | |
| "pageElement":"id('propertylist')/span/ul/li", | |
| "nextLink":"//a[@class='ico_arw_rht16']", | |
| "wedata.net.id":32055 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?coolboys\\.jp/pic/face\\d\\d?/", | |
| "pageElement":"id(\"read\")", | |
| "nextLink":"id(\"page\")/a[contains(text(),\"\u6b2120\u4ef6\")]", | |
| "wedata.net.id":27447 | |
| }, | |
| { | |
| "url":"^http://www\\.parkoz\\.com/zboard/zboard\\.php\\?", | |
| "pageElement":"//tr[@class='TRBG']", | |
| "nextLink":"//tr[./td[@class=\"thm9g\"]]/following-sibling::tr[1]//font[./b]/following-sibling::a[1]", | |
| "wedata.net.id":54433 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?xhamster(?:premiumpass)?\\.com", | |
| "pageElement":"//div[contains(concat(\" \", @class, \" \"), \"videoList\")]/div[@class=\"video\"] | id(\"video_title\")/div/* | //tr[(td/div | td/div/div)[contains(concat(' ', @class, ' '), ' galleryItem ') or contains(concat(' ', @class, ' '), ' dvdItem ') or contains(concat(' ', @class, ' '), ' favItem ') or contains(concat(' ', @class, ' '), ' actorItem ')]] | (id('blog') | id('search_posts'))/div[@class='post'] | //div[@class='boxC']//div[@class='video' or @class='clear']", | |
| "nextLink":"//div[@class='pager']//a[@class='last'] | //span[@class='navNext']/a | //div[contains(concat(\" \", @class, \" \"), \"iconPagerNext\")]/parent::a", | |
| "wedata.net.id":32486 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?tepore\\.com/user/life/recipe/", | |
| "pageElement":"//div[@class=\"box_content boxLink\"]", | |
| "nextLink":"//span[@class=\"pg_next\"]/a", | |
| "wedata.net.id":25718 | |
| }, | |
| { | |
| "url":"^http:\\/\\/www\\.meditations\\.jp\\/.*disp_order", | |
| "pageElement":"//table//tr[td]", | |
| "nextLink":"//a[@title=' 次のページ ']", | |
| "wedata.net.id":64661 | |
| }, | |
| { | |
| "url":"^http://news\\.search\\.yahoo\\.co\\.jp/search\\?", | |
| "pageElement":"//div[@class='l cf']", | |
| "nextLink":"id('Sp1')/p/strong/following-sibling::a[1]", | |
| "wedata.net.id":34063 | |
| }, | |
| { | |
| "url":"^http://search\\.nifty\\.com/websearch/search\\?.", | |
| "pageElement":"id(\"wSrch\")/ul[@onmouseup=\"atsearch_nazoru_mouseup(event)\"]", | |
| "nextLink":"//span[@class=\"next\"]/a", | |
| "wedata.net.id":2417 | |
| }, | |
| { | |
| "url":"^http://(?:www|jibun)\\.atmarkit\\.co\\.jp/.*five", | |
| "pageElement":"id(\"headmenu\")/following-sibling::*[following-sibling::*[(descendant::img[@src=\"/images/next2.gif\" or @src=\"/images/prev.gif\"]) or (descendant::img[@src=\"/images/thispag2.gif\"] and not(preceding-sibling::*/descendant::img[@src=\"/images/next2.gif\" or @src=\"/images/prev.gif\"]))]]", | |
| "nextLink":"//img[@src=\"/images/thispag2.gif\"]/ancestor::tr/following-sibling::tr[1]//a", | |
| "wedata.net.id":2445 | |
| }, | |
| { | |
| "url":"^http://www\\.vector\\.co\\.jp/magazine/softnews/", | |
| "pageElement":"id(\"v_wrapper\")/table/tbody/tr/td/table[@width=\"99%\"]", | |
| "nextLink":"//div[@class=\"pagination\"]/ul/li/a[contains(text(),\"次へ\")]", | |
| "wedata.net.id":61753 | |
| }, | |
| { | |
| "url":"^http://blog\\.livedoor\\.jp/nicovip2ch/archives/", | |
| "pageElement":"//div[@class=\"article-body-more\"]/div[@style][1]/following-sibling::*[following-sibling::div[@class=\"pcNone\"]]|//a[@name=\"more\"]/preceding-sibling::*|//div[@class=\"article-header\" or @class=\"article-footer\"]|id(\"comments-list\")/*", | |
| "nextLink":"//a[@rel=\"prev\"]", | |
| "wedata.net.id":80788 | |
| }, | |
| { | |
| "url":"^http://yukitubaki\\.choumusubi\\.com/(?!ormenu).", | |
| "pageElement":"//*[self::p or self::center]", | |
| "nextLink":"//a[(descendant::img or parent::center) and not(starts-with(@href, \"http\"))]", | |
| "wedata.net.id":39991 | |
| }, | |
| { | |
| "url":"^http://d\\.hatena\\.ne\\.jp/Chikirin(?!\\+shogi)", | |
| "pageElement":"//div[@class='section'][not(//link[contains(@href,'+shop')]/@rel='canonical')]/*[not(.//a[@class='http-image'][img[@width='220' or @width='180']] or @class='share-button sectionfooter')]|//div[@class='day']/h2|//p[@class='share-button sectionfooter'][//link[contains(@href,'+shop')]/@rel='canonical']/preceding-sibling::p[a[contains(@href,'rakuten')]][1]/preceding-sibling::*", | |
| "nextLink":"//a[@rel='prev'][not(@href='/Chikirin+shop/20131001')]", | |
| "wedata.net.id":77193 | |
| }, | |
| { | |
| "url":"^http://(lite\\.)?modarchive\\.org/index\\.php\\?", | |
| "pageElement":"//tr[starts-with(@class,'songlistrow') or .//@class='format-icon']", | |
| "nextLink":"//a[@class='dummy' or @class='pagination'][contains(.,'>')]", | |
| "wedata.net.id":31846 | |
| }, | |
| { | |
| "url":"^http://1stpower\\.web\\.fc2\\.com/comic(?:\\d+)?", | |
| "pageElement":"//div[contains(concat(\" \", @class, \" \"), \" main \")]/table", | |
| "nextLink":"//a[contains(img/@src, \"next.gif\")]", | |
| "wedata.net.id":50480 | |
| }, | |
| { | |
| "url":"^http://www\\.hakusuisha\\.co\\.jp/(search|news)/", | |
| "pageElement":"//ul[@class='listType1 ro matchHeight']/li|//div[@class='newsListWrap']/*", | |
| "nextLink":"//div[@class='paging']//strong/following-sibling::a[1]", | |
| "wedata.net.id":64176 | |
| }, | |
| { | |
| "url":"^http://www\\.pocketbooks-japan\\.com/index\\.php", | |
| "pageElement":"//table[@class=\"listBox\"]/tbody/tr[td]", | |
| "nextLink":"//p[@class=\"listPrevNext\"]/strong/following-sibling::a[1]", | |
| "wedata.net.id":30657 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?daily\\.co\\.jp/.*[0-9]+.shtml", | |
| "pageElement":"id(\"NWrelart:Body\")/p[last()][./a]/preceding-sibling::*|id(\"NWrelart:Body\")[not(./p[last()][./a])]/* | //div[@class=\"photoPage2\"]", | |
| "nextLink":"//a[../@class=\"numNext\" or @class=\"photo_button_next\"]", | |
| "wedata.net.id":64838 | |
| }, | |
| { | |
| "url":"^http://(?:[es]c\\.)?akizukidenshi\\.com/catalog/", | |
| "pageElement":"id(\"hyouji\")/following-sibling::div[@class=\"navipage_\"][1]/following-sibling::*[./following-sibling::*/descendant-or-self::div[@class=\"navipage_\"]]", | |
| "nextLink":"id(\"hyouji\")/following-sibling::div[@class=\"navipage_\"]/a[img[starts-with(@alt,\"次\")]]", | |
| "wedata.net.id":25871 | |
| }, | |
| { | |
| "url":"^http://dic\\.search\\.yahoo\\.co\\.jp/dsearch\\?", | |
| "pageElement":"id('DS2m ES2m')/ol/li", | |
| "nextLink":"id('Sp1')//strong/following-sibling::a[1]", | |
| "wedata.net.id":25846 | |
| }, | |
| { | |
| "url":"^http://rienoatorie\\.web\\.fc2\\.com/\\w+\\.html", | |
| "pageElement":"//*[self::p or self::h1]", | |
| "nextLink":"//img/following::a[position()=1 and not(starts-with(@href, 'mokuji'))]", | |
| "wedata.net.id":40624 | |
| }, | |
| { | |
| "url":"^http://kazuyomugi\\.cocolog-nifty\\.com/private/", | |
| "pageElement":"//div[@class=\"entry\"]/div[@class=\"mt10\"]/preceding-sibling::*", | |
| "nextLink":"//link[@rel=\"prev\"]", | |
| "wedata.net.id":80683 | |
| }, | |
| { | |
| "url":"^http://www\\.slmame\\.com/admin/atja_point\\.php", | |
| "pageElement":"//table[@class=\"data_table\"]/tbody/tr[2]", | |
| "nextLink":"//div[@class=\"block\"]/a[starts-with(text(),\"\u00ab\")]", | |
| "wedata.net.id":25815 | |
| }, | |
| { | |
| "url":"^http://www\\.optimagraphics\\.org/dannna_o/blog/", | |
| "pageElement":"id(\"content\")/div[contains(@class,\"post\") or self::*[@id=\"comments\"][h3[contains(.,\"Comment\")]]]", | |
| "nextLink":"//a[contains(text(), \"Older Entries\") or contains(text(), \"前の投稿へ\")]", | |
| "wedata.net.id":29537 | |
| }, | |
| { | |
| "url":"^http://park\\.ajinomoto\\.co\\.jp/recipe/search?", | |
| "pageElement":"//ul[@class='recipeDoc_list']/*", | |
| "nextLink":"//ul[@class='recipeCardComPager']/li[last()]/a", | |
| "wedata.net.id":80800 | |
| }, | |
| { | |
| "url":"^http://blog\\.goo\\.ne\\.jp/moonglass_net(?:/|$)", | |
| "pageElement":"//div[@class='mod-entry-set'][not(@id)]", | |
| "nextLink":"//li[@class='mod-pre-nex-prev']/a", | |
| "wedata.net.id":26600 | |
| }, | |
| { | |
| "url":"^http://orbita\\.holy\\.jp/\\w+/\\d+/\\d+\\.html", | |
| "pageElement":"id(\"main2 sita-main\")/*[self::a[img] or self::img or self::p]", | |
| "nextLink":"//a[img]", | |
| "wedata.net.id":57228 | |
| }, | |
| { | |
| "url":"^https://opac\\.lib\\.city\\.yokohama\\.lg\\.jp/", | |
| "pageElement":"//tr[td/@class='nowrap meisai_no']", | |
| "nextLink":"//a[contains(text(), \"次のページ\")]", | |
| "wedata.net.id":75036 | |
| }, | |
| { | |
| "url":"^http://q\\.hatena\\.ne\\.jp/(touch|mobile)/list", | |
| "pageElement":"//li[contains(@class,\"list-question\")]|//body/node()[preceding-sibling::hr[1]][following-sibling::center[contains(.,'-')]]", | |
| "nextLink":"//a[@class='pager-r' or @directkey='6']", | |
| "wedata.net.id":55521 | |
| }, | |
| { | |
| "url":"^http://((sports|pann)\\.)?(news\\.)?nate\\.com/", | |
| "pageElement":"//table[@class='talk_list']/tbody/tr|//div[@class='mduSubjectList' or contains(@class,'postPhoto') or @class='clusterbox'] | //ul[@class='post_wrap' or contains(@class,'m-list') or @class='mduTitcnt' or contains(@class,'mphotolist') or @class='vodPlay']/li", | |
| "nextLink":"//a[img/@alt='다음' or @class='button-next']|//div[contains(@class,'pagin')]//strong[not(span)]/following-sibling::a[1]|//li[@class='first-child on']/following-sibling::li/a[not(//div[contains(@class,'paging')]/strong/following-sibling::a)]", | |
| "wedata.net.id":54181 | |
| }, | |
| { | |
| "url":"^http://www\\.toei-anim\\.co\\.jp/sp/kyousogiga/", | |
| "pageElement":"id(\"titlecharactor\")/div[@class]", | |
| "nextLink":"//a[contains(text(), \"次へ\")]", | |
| "wedata.net.id":63322 | |
| }, | |
| { | |
| "url":"^http://renta\\.papy\\.co\\.jp/renta/sc/frm/list", | |
| "pageElement":"id(\"mainwrap\")/*[@class=\"list_box\" or @class=\"clear\" or @class=\"list_cover_title\"]", | |
| "nextLink":"//b/a[starts-with(normalize-space(), \"次の\")]", | |
| "wedata.net.id":74799 | |
| }, | |
| { | |
| "url":"^http://search-web\\.slmame\\.com/cgi-bin/search", | |
| "pageElement":"id(\"searchresult\")/div[@class=\"content\"]/div[contains(@class,\"unit\")]", | |
| "nextLink":"id(\"searchresult\")//p[contains(concat(\" \",@class,\" \"),\" pager \") and last()]/a[last() and contains(text(),\"\u6b21\")]", | |
| "wedata.net.id":2462 | |
| }, | |
| { | |
| "url":"^http://chat\\.pixiv\\.net/search\\.php(?:$|\\?)", | |
| "pageElement":"//div[@class=\"pager\"]/preceding-sibling::div[@class=\"top_new\" or @class=\"clear\"]", | |
| "nextLink":"//a[@class=\"pagerolder\"]", | |
| "wedata.net.id":34065 | |
| }, | |
| { | |
| "url":"^http://fukuchi\\.cocolog-nifty\\.com/(blog|cat)", | |
| "pageElement":"//div[@class=\"entry\"]/*[self::h3 or @class=\"entry-body\" or @class=\"entry-trackback trackbacks entry-recent-posts\" or @class=\"entry-body-top\" or @class=\"posted\" or @class=\"entry-comment\"]|//h2[contains(.,\"年\")]", | |
| "nextLink":"//div[@class='entry-nav']/p/a|//div[@class='archive-content']//li[@class='archive-list-item'][1]/a", | |
| "wedata.net.id":75031 | |
| }, | |
| { | |
| "url":"^http://magazine\\.mahjong-rule\\.com/colmun\\d+", | |
| "pageElement":"id(\"sub_con_left\")", | |
| "nextLink":"//a[contains(text(),\"/\") and not(starts-with(@href,\"colmun10\"))]|id(\"sub_con_left\")/a[contains(text(),concat(id(\"title\")/text(),\"2\"))]|id(\"sub_con_left\")/a[contains(text(),substring(string(id(\"title\")/text()),string-length(string(id(\"title\")/text())),string-length(string(id(\"title\")/text())))+1)]|id(\"sub_con_left\")/a[contains(text(),number(substring-before(substring-after(id(\"sub_con_left\")/a[contains(text(),id(\"title\")/text())][last()],\"NO\"),\":\"))+1)]|id(\"sub_con_left\")/a[contains(@href,concat(number(substring-before(substring-after(id(\"title\")/text(),\"[\"),\"]\")),\".html\"))]", | |
| "wedata.net.id":55604 | |
| }, | |
| { | |
| "url":"^http://www\\.chefkoch\\.de/(?:rs/s|suche\\.php)", | |
| "pageElement":"//li[@class='search-list-item']", | |
| "nextLink":"//a[@class='pagination-item pagination-next']", | |
| "wedata.net.id":27466 | |
| }, | |
| { | |
| "url":"^http://imagesearch\\.excite\\.co\\.jp/\\?search", | |
| "pageElement":"id('resultList')/li", | |
| "nextLink":"//li[span/@class='cr']/following-sibling::li[1]/a", | |
| "wedata.net.id":28920 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?flinker\\.jp/keyword/fkeyword", | |
| "pageElement":"id('wikipedia')//tr[@id]", | |
| "nextLink":"id('wikipedia')/following::div[@class='right']/a", | |
| "wedata.net.id":26470 | |
| }, | |
| { | |
| "url":"^http://dall\\.nobody\\.jp/logs/.+/.+\\d+\\.html", | |
| "pageElement":"//dl", | |
| "nextLink":"//a[contains(text(),\"次へ\")]", | |
| "wedata.net.id":63825 | |
| }, | |
| { | |
| "url":"^https?://.+\\.wikipedia\\.org/w(iki)?/.*search=", | |
| "pageElement":"//ul[@class='mw-search-results']/li", | |
| "nextLink":"//a[@class='mw-nextlink']", | |
| "wedata.net.id":565 | |
| }, | |
| { | |
| "url":"^http://webshop\\.montbell\\.jp/goods/list\\.php", | |
| "pageElement":"//div[@class=\"unit\"]", | |
| "nextLink":"//a[@title=\"\u6b21\u306e\u30da\u30fc\u30b8\u3078\"]", | |
| "wedata.net.id":32050 | |
| }, | |
| { | |
| "url":"^http://www\\.sherdog\\.com/stats/fightfinder\\?", | |
| "pageElement":"//table[@class='fightfinder_result']//tr[not(td/@class)]", | |
| "nextLink":"//a[.='Next »']", | |
| "wedata.net.id":59286 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?freespot\\.com/map/list\\.php", | |
| "pageElement":"id(\"index\")/following-sibling::tr", | |
| "nextLink":"//a[text()=\"\u6b21\u3092\u8868\u793a\"]", | |
| "wedata.net.id":2661 | |
| }, | |
| { | |
| "url":"^http://now\\.ameba\\.jp/[^/]+/follow(?:ers|ing)", | |
| "pageElement":"id(\"nowListArea\")/li", | |
| "nextLink":"//div[@class=\"paging\"]/a[@class=\"right\"]", | |
| "wedata.net.id":30738 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?nikkeibook\\.com/errata\\.php", | |
| "pageElement":"id('searchResult')//tr[td]", | |
| "nextLink":"id('searchResult')//a[contains(.,'>>')]", | |
| "wedata.net.id":27634 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?rice-boy\\.(?:com|jpn\\.org)/", | |
| "pageElement":"//a[./img[contains(@alt, \"Page\") or @alt=\"comic\"]]", | |
| "nextLink":"//a[./img[contains(@alt, \"Page\") or @alt=\"comic\"]]", | |
| "wedata.net.id":32446 | |
| }, | |
| { | |
| "url":"^http://tv\\.yahoo\\.co\\.jp/review/detail/\\d+/", | |
| "pageElement":"id(\"main\")/descendant::div[contains(concat(\" \", @class, \" \"), \" commentContainer \")]", | |
| "nextLink":"//span[contains(concat(\" \", @class, \" \"), \" paging \")]/a[.=\"次の感想\"]", | |
| "wedata.net.id":59801 | |
| }, | |
| { | |
| "url":"^http://www\\.imagefap\\.com/showfavorites\\.php", | |
| "pageElement":"//div[@id=\"main\"]/center/center/table/tbody/tr/td/table/tbody/tr/td/table[3]/preceding-sibling::node()", | |
| "nextLink":"//a[(text()=\":: next ::\")]", | |
| "wedata.net.id":77493 | |
| }, | |
| { | |
| "url":"^http://www\\.geocities\\.jp/anewlevel777/comic/", | |
| "pageElement":"//center/table", | |
| "nextLink":"//center/a[.='←次のページ']", | |
| "wedata.net.id":45688 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?pimpyourfont\\.com/by-style/.", | |
| "pageElement":"//div[@class=\"content-i\"]/table", | |
| "nextLink":"//a[contains(concat(\" \",@class,\" \"),\" nav_cur \")][last()]", | |
| "wedata.net.id":28953 | |
| }, | |
| { | |
| "url":"^http://(s(?:earch|hopping)\\.)?goodsearch\\.jp/", | |
| "pageElement":"//div[@class='site']//li|id(\"main\")/table[@class=\"pagenavi\"]/following-sibling::*[(self::div or self::table) and not(@class=\"mokuji\" or @class=\"pagenavi\")]", | |
| "nextLink":"//span[@class='rs']/following-sibling::a[1]|//a[img/@src='img/button_next.gif']", | |
| "wedata.net.id":32418 | |
| }, | |
| { | |
| "url":"^http://www\\.kadokawa\\.co\\.jp/product/search/", | |
| "pageElement":"id('search_result')//tr[td]", | |
| "nextLink":"//span[@class='next']/a", | |
| "wedata.net.id":77733 | |
| }, | |
| { | |
| "url":"^https?://academic\\.research\\.microsoft\\.com/", | |
| "pageElement":"//div[@class='section-wrapper']/ul/li", | |
| "nextLink":"//a[contains(@id,'MainContent_PaperList_Next')]", | |
| "wedata.net.id":2838 | |
| }, | |
| { | |
| "url":"^https?://azure\\.microsoft\\.com/ja-jp/updates/", | |
| "pageElement":"//div[@class=\"serviceUpdate\"]", | |
| "nextLink":"//div[@class=\"wa-pagination\"]//li[last()]/a", | |
| "wedata.net.id":80972 | |
| }, | |
| { | |
| "url":"^http://www\\.nikkeibp\\.co\\.jp/(article|atcl)/", | |
| "pageElement":"//div[contains(@class,\"pagination\")]/preceding-sibling::*[1]/*[not(contains(@class,\"next\") or @class=\"article-title\" or @class=\"wrapper\")]", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":2810 | |
| }, | |
| { | |
| "url":"^http://www\\.aitendo\\.com/product-(list|group)", | |
| "pageElement":"//li[div/@class='item_data clearfix']", | |
| "nextLink":"id('pagertop')/a[@class='to_next_page']", | |
| "wedata.net.id":76352 | |
| }, | |
| { | |
| "url":"^http://www7a\\.biglobe\\.ne\\.jp/\\~thor/novel/", | |
| "pageElement":"//div[@class='footer']/preceding-sibling::*", | |
| "nextLink":"id('NextDoc')", | |
| "wedata.net.id":64720 | |
| }, | |
| { | |
| "url":"^http://counter\\.hatena\\.ne\\.jp/.+?/report\\?", | |
| "insertBefore":"//div[@class=\"pager\"][last()]", | |
| "pageElement":"id(\"hourlyreport\")/table", | |
| "nextLink":"//div[@class=\"pager\"][last()]/a[last()]", | |
| "wedata.net.id":26952 | |
| }, | |
| { | |
| "url":"^https?://.+\\.(minoland|pcfuns|chiphell)\\.com/", | |
| "pageElement":"//dl[@class='bbda cl']|id('article_content')", | |
| "nextLink":"//a[@class='nxt']", | |
| "wedata.net.id":77368 | |
| }, | |
| { | |
| "url":"^http://www\\.excite\\.co\\.jp/News/\\w+/author/", | |
| "pageElement":"id(\"contents\")/div[@class=\"newsList\"]", | |
| "nextLink":"//li[@class=\"next\"]/a", | |
| "wedata.net.id":64266 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?webdesign(?:file|clip)\\.com/", | |
| "pageElement":"id('Wdf')/ul//li[figure]", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":1575 | |
| }, | |
| { | |
| "url":"^http://admin-apps\\.isiknowledge\\.com+/JCR/JCR", | |
| "pageElement":"//table[@bordercolor=\"#cccccc\"]", | |
| "nextLink":"//a[img[contains(@src,\"nextpga.gif\")]]", | |
| "wedata.net.id":32387 | |
| }, | |
| { | |
| "url":"^http://www\\.dmm\\.co(?:m|\\.jp)/[^/]+/digital/", | |
| "pageElement":"id('_bandaiall')/ul/li", | |
| "nextLink":"//link[@rel='next']", | |
| "wedata.net.id":2234 | |
| }, | |
| { | |
| "url":"^https?://developer\\.mozilla\\.org/[^/]+/docs/", | |
| "pageElement":"id(\"wiki-document-head wiki-column-container\")", | |
| "nextLink":"//div[@class=\"prevnext\"]/p/a[last()]", | |
| "wedata.net.id":927 | |
| }, | |
| { | |
| "url":"^http://serpent\\.sub\\.jp/diarypro/diary\\.cgi", | |
| "pageElement":"id(\"diary\")", | |
| "nextLink":"id(\"page\")/ul/li[2]/a", | |
| "wedata.net.id":33749 | |
| }, | |
| { | |
| "url":"^https://www\\.joysound\\.com/utasuki/userpage/", | |
| "pageElement":"//ul[contains(@class,'usk-list-new')]/li", | |
| "nextLink":"//div[@class='jp-cmp-sp-none']/ol/li[@class='jp-cmp-active']/following-sibling::li[1]/a", | |
| "wedata.net.id":76509 | |
| }, | |
| { | |
| "url":"^http://atihear\\.uunyan\\.com/\\d+wa/1\\.html$", | |
| "pageElement":"id('main')", | |
| "nextLink":"//div/a[2]", | |
| "wedata.net.id":72731 | |
| }, | |
| { | |
| "url":"^http://tegaki\\.pipa\\.jp/[0-9]+/[0-9]+\\.html", | |
| "pageElement":"//div[@class='ContentsList']/*[not(table/@class='NaviBar')]", | |
| "nextLink":"//td[@class=\"Navi_N\"]/a", | |
| "wedata.net.id":73920 | |
| }, | |
| { | |
| "url":"^http://www\\.getchu\\.com/php/calendar\\.phtml", | |
| "pageElement":"//div[@align=\"center\"][div and center]/table", | |
| "nextLink":"//div[@align=\"center\"][div and table]/center[(count(a)=1 and contains(concat(a/@href,\" \"),\"page=1 \")) or count(a)=2]/a[last()]", | |
| "wedata.net.id":470 | |
| }, | |
| { | |
| "url":"^http://live\\.nicovideo\\.jp/(?:recent|search)", | |
| "pageElement":"//ul[@class='user-programs']/li", | |
| "nextLink":"id('pager-block')/a[@class='next']", | |
| "wedata.net.id":29579 | |
| }, | |
| { | |
| "url":"^http://www\\.scientificamerican\\.com/podcasts", | |
| "pageElement":"//section[@class='container']/div[section]", | |
| "nextLink":"//div[@class='pagination__right']/a", | |
| "wedata.net.id":535 | |
| }, | |
| { | |
| "url":"^http://(info|news)\\.finance.\\yahoo\\.co\\.jp", | |
| "pageElement":"//li[@class='shRankingBodyItm']|//div[@class='marB15 clearFix']|//table[@class='rankingTable']/tbody/tr", | |
| "nextLink":"//a[@title='次へ' or .='次のページ' or .='次へ']", | |
| "wedata.net.id":25631 | |
| }, | |
| { | |
| "url":"^http://www\\.mobypicture\\.com/user/\\w+/view/", | |
| "pageElement":"id(\"user_view\")", | |
| "nextLink":"id(\"view_navigation_thumbs\")/a[@href=//form[@method=\"POST\"]/@action]/preceding-sibling::a", | |
| "wedata.net.id":65427 | |
| }, | |
| { | |
| "url":"^http://www\\.animesachi\\.com/(?:use|visito)r/", | |
| "pageElement":"//table[@class='normal']//tr[td]", | |
| "nextLink":"id('main')//a[@title='次のページへ']|(id('main')//a[starts-with(., '次へ')])[last()]", | |
| "wedata.net.id":32089 | |
| }, | |
| { | |
| "url":"^http://www\\.getchu\\.com/php/n?search\\.phtml", | |
| "pageElement":"//ul[contains(concat(\" \",@class,\" \"),\" display \")]", | |
| "nextLink":"//a[@title=\"next page\"]|//td/b/following-sibling::a", | |
| "wedata.net.id":471 | |
| }, | |
| { | |
| "url":"^http://(shopping|ecshweb)\\.pchome\\.com\\.tw/", | |
| "pageElement":"//tr[td[@align='center'][@valign='top'][@width='146']]", | |
| "nextLink":"//font[@class='text18_page123'][@color='#ff0000']/following-sibling::a[1]", | |
| "wedata.net.id":48842 | |
| }, | |
| { | |
| "url":"^http://seiga\\.nicovideo\\.jp/user/illust/\\d+", | |
| "pageElement":"//*[contains(@class, \"autopagerize_page_element\")]rn", | |
| "nextLink":"id('mg_main_column')/div[5]/div/ul/li[12]/a", | |
| "wedata.net.id":54850 | |
| }, | |
| { | |
| "url":"^http://www\\.pasonacareer\\.jp/hatalabo/entry/", | |
| "pageElement":"//div[@class=\"entry-inner\"]/*[not(@class=\"entry-footer\")]|//footer[@class=\"entry-footer\"]/*[not(@class=\"customized-footer\")]", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":77558 | |
| }, | |
| { | |
| "url":"^http://techtarget\\.itmedia\\.co\\.jp/tt/news/", | |
| "pageElement":"//*[@id=\"cmsBody\"]/div/div[1]/following-sibling::*[ following:://*[@id=\"endlinkConnection\"] ]", | |
| "nextLink":"//*[@id=\"next\"]", | |
| "wedata.net.id":80948 | |
| }, | |
| { | |
| "url":"^http://talestune\\.s53\\.coreserver\\.jp/blog/", | |
| "pageElement":"id(\"content\")//li", | |
| "nextLink":"//span[@class=\"current\"]/following-sibling::a[1]", | |
| "wedata.net.id":38435 | |
| }, | |
| { | |
| "url":"^http://d\\.hatena\\.ne\\.jp/keywordlist($|\\?)", | |
| "pageElement":"//div[@class=\"keyword-list\"]/ul/li[not(@class=\"pager\")]", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":1700 | |
| }, | |
| { | |
| "url":"^http://dynabook\\.com/pc/manga/page/\\d+\\.htm", | |
| "pageElement":"id(\"manga\")/*", | |
| "nextLink":"id(\"manga\")/descendant::div[contains(concat(\" \", @class, \" \"), \" btn_next \") or contains(concat(\" \", @class, \" \"), \" btn_latter \")]/a", | |
| "wedata.net.id":55814 | |
| }, | |
| { | |
| "url":"^http://[^./]+\\.[^-./]+-(?:enshu|nifty)\\.com/", | |
| "pageElement":"//div[@class=\"content\" or @class=\"pkg\"]/div[@class=\"entry\"]/*[not(@class=\"content-nav\")]|//div[@class=\"content\" or @class=\"pkg\"]/div[@class=\"entry\"]/preceding-sibling::h2", | |
| "nextLink":"//link[@rel=\"prev\"] | //*[@class=\"entry-nav\" or @class=\"content-nav\"]//a[1][not(@href=//link[@rel=\"start\"]/@href)]", | |
| "wedata.net.id":1040 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?[^-]+-bbs\\.com/cgi-bin/bbs/", | |
| "pageElement":"//td[contains(@class,\"bbsCont1\")]/table[contains(@class,\"bbsContEnt\")]", | |
| "nextLink":"//a[starts-with(@href,\"?page=\") and preceding-sibling::b]", | |
| "wedata.net.id":25791 | |
| }, | |
| { | |
| "url":"^http://wordgear\\.sblo\\.jp/(?:article|index)?", | |
| "pageElement":"id(\"content\")/*[@class=\"blog\" or @color=\"#3d3d3d\"]", | |
| "nextLink":"//div[@class='navi']/a[1][not(@href='http://wordgear.sblo.jp/')]", | |
| "wedata.net.id":28818 | |
| }, | |
| { | |
| "url":"^http://r25\\.yahoo\\.co\\.jp/interview/detail/", | |
| "pageElement":"id('md_interviewdetail')//div[@class='section']/*", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":1776 | |
| }, | |
| { | |
| "url":"^http://www.aozora\\.gr\\.jp/index_pages/person", | |
| "pageElement":"//descendant::div[h1]/following-sibling::node()[following-sibling::div[contains(text(),\"作家リスト:公開中\")]]", | |
| "nextLink":"//div[contains(text(),\"作家リスト:公開中\")]/*[@class=\"current\"]/following-sibling::a[1]", | |
| "wedata.net.id":74943 | |
| }, | |
| { | |
| "url":"^http://d\\.hatena\\.ne\\.jp/designset(?:$|\\?)", | |
| "pageElement":"//table[@class=\"table-list\"]//tr[contains(@class,\"hatena-star-entry\")]", | |
| "nextLink":"//div[@class=\"pager-r\"]/a[last()]", | |
| "wedata.net.id":25981 | |
| }, | |
| { | |
| "url":"^http://g\\.hatena\\.ne\\.jp/grouplist(?:$|\\?)", | |
| "pageElement":"//table[@class='listtable2']//tr[td]", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":26216 | |
| }, | |
| { | |
| "url":"^http://www\\.tg-net\\.co\\.jp/item_list\\.html", | |
| "pageElement":"//div[@class=\"box\"]", | |
| "nextLink":"//a[text() = \"次ページを表示\"]", | |
| "wedata.net.id":64691 | |
| }, | |
| { | |
| "url":"^http://www\\.nikkeibp\\.co\\.jp/style/biz/abc/", | |
| "pageElement":"id(\"mb_title\")/following-sibling::node() | id(\"author_profile\")", | |
| "nextLink":"id(\"pages\")/tbody/tr/td[last()]/a", | |
| "wedata.net.id":1815 | |
| }, | |
| { | |
| "url":"^http://musiatui\\.blog111\\.fc2\\.com/(?!blog)", | |
| "pageElement":"//div[@class=\"side-body\"]/following-sibling::*[not(@class=\"entry-title\")][./following-sibling::div[@id=\"content-nav\"]]|//h2[@class=\"entry-title\"][@id]", | |
| "nextLink":"id(\"content-nav\")[count(./a)>1 or ./a[@href=\"http://musiatui.blog111.fc2.com/page-1.html\" or @href=\"/archives.html?p=2\"]]/a[last()]", | |
| "wedata.net.id":80992 | |
| }, | |
| { | |
| "url":"^http://cloud\\.watch\\.impress\\.co\\.jp/docs/", | |
| "pageElement":"//div[@class=\"tab-wrap\"]/preceding-sibling::node()", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":74360 | |
| }, | |
| { | |
| "url":"^http://www\\.geocities\\.jp/cba4jp/j\\d+-\\d+/", | |
| "pageElement":"//center/table", | |
| "nextLink":"//center//a[img] | //center//area", | |
| "wedata.net.id":32850 | |
| }, | |
| { | |
| "url":"^http://cgiserv01\\.fc2web\\.com/g-i-m-g-s/top/", | |
| "pageElement":"//table[last()]//tr[@bgcolor='#FFFFFF']", | |
| "nextLink":"//a[starts-with(@href,'top_')][last()]", | |
| "wedata.net.id":29819 | |
| }, | |
| { | |
| "url":"^https://packagecontrol\\.io/(search|browse)/.+", | |
| "pageElement":"//li[@class=\"package\"]", | |
| "nextLink":"//a[@class=\"selected\"]/following-sibling::a", | |
| "wedata.net.id":77061 | |
| }, | |
| { | |
| "url":"^http://www\\.tokyomangasha\\.com/.+\\d+\\.html", | |
| "pageElement":"//div[@class=\"kikan\"]/*", | |
| "nextLink":"//li[@class=\"home\"]/following-sibling::li/a", | |
| "wedata.net.id":72644 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?spiralmarket\\.com/archives/", | |
| "pageElement":"id(\"main\")//div[@class=\"headline\"]/p[@class=\"pageNavgation\"][1]/following-sibling::*[following-sibling::p[@class=\"pageNavgation\"]]", | |
| "nextLink":"id(\"main\")//p[@class=\"pageNavgation\"]/span[last()]/a", | |
| "wedata.net.id":30683 | |
| }, | |
| { | |
| "url":"^http://www\\.animewallpapers\\.com/wallpapers/", | |
| "pageElement":"//table[@class=\"maintable\"]/tbody/tr", | |
| "nextLink":"//table[@class=\"taborder\"]//a[contains(., \">\")]", | |
| "wedata.net.id":29492 | |
| }, | |
| { | |
| "url":"^https?://(?:www\\.)?flickr\\.com/photos/[^/]+/", | |
| "pageElement":"//div[@role='main']/div[starts-with(@class,'view photo-list-view')]", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":31256 | |
| }, | |
| { | |
| "url":"^https://www\\.iichi\\.com/(?:listing|category)", | |
| "pageElement":"//ul[@class='listing clearfix']/li", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":62724 | |
| }, | |
| { | |
| "url":"^https://www\\.pplog\\.net/my/(favorites|posts)", | |
| "pageElement":"//ul[@class='favorites']|//div[@class='posts-of-the-day']", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":76969 | |
| }, | |
| { | |
| "url":"^http://www\\.kabudragon\\.com/ranking/agechart", | |
| "pageElement":"//table[@class=\"rankingFrame\"][not(.//th[@nowrap=\"nowrap\"])]|//table[@class=\"rankingFrame\"]/following-sibling::p", | |
| "nextLink":"//div[@class=\"searchPagination\"]/b/following-sibling::a[1]", | |
| "wedata.net.id":77065 | |
| }, | |
| { | |
| "url":"^http://pc\\.nikkeibp\\.co\\.jp/(article|atcl)/", | |
| "insertBefore":"id(\"explainLink\")", | |
| "pageElement":"id(\"co_explain\")/*[not(@id='co_sbmpcobm' or @id=\"co_explainLink\" or @id=\"co_capArea\" or @id=\"thisIndex\" or @id=\"rPR_yellow\" or @id=\"printarea\")]", | |
| "nextLink":"id(\"co_pagenumLink\")/p[@class=\"arrowR\"]/a", | |
| "wedata.net.id":750 | |
| }, | |
| { | |
| "url":"^https?://forums\\.robertsspaceindustries\\.com", | |
| "pageElement":"//div[@class='CommentsWrap']/div[ul]|id('contentbody SphinxResults')//ul", | |
| "nextLink":"//a[.='2' and //a[@rel='next']='1' or @rel='next' and .!='1']", | |
| "wedata.net.id":76891 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?ota-suke\\.jp/(list|special)", | |
| "pageElement":"//h2[@class=\"datehead\"]|//div[@class=\"news_list\"]//li|//div[./span[contains(@style,\"float:left;\")]/a/strong]/preceding-sibling::div[not(@class=\"clear\")][1]", | |
| "nextLink":"//div[@class=\"pager\"]/div[@style=\"float:right;\"]/a[@class=\"link\"]|//span[contains(@style,\"float:left;\")]/a[./strong]", | |
| "wedata.net.id":27275 | |
| }, | |
| { | |
| "url":"^http://www\\.books\\.or\\.jp/ResultList\\.aspx", | |
| "pageElement":"id('htBookList')//tr[td]", | |
| "nextLink":"id('hlNext2')", | |
| "wedata.net.id":64708 | |
| }, | |
| { | |
| "url":"^https://publications\\.asahi\\.com/ecs/search/", | |
| "pageElement":"//div[@class='searchResultList']//li", | |
| "nextLink":"//td[@class='next']/a", | |
| "wedata.net.id":63190 | |
| }, | |
| { | |
| "url":"^https?://addons\\.opera\\.com/\\w+/extensions/", | |
| "pageElement":"//article/ul/li", | |
| "nextLink":"//div[@class=\"pagination\"]//a[@title=\"Next page\"]", | |
| "wedata.net.id":40598 | |
| }, | |
| { | |
| "url":"^http://.+\\.sblo\\.jp/?(index(-\\d+)?\\.html)?", | |
| "pageElement":"//div[@id=\"content\"]/div[@class=\"blog\"]", | |
| "nextLink":"//div[@class=\"navi\"][not(count(./a)=3)]/a[last()][not(./self::a/@href=//div[@class=\"navi\"]/a[1]/@href) or contains(@href,\"index-2.html\")]", | |
| "wedata.net.id":63712 | |
| }, | |
| { | |
| "url":"^https?://www\\.superdelivery\\.com/p/do/d?psl/", | |
| "pageElement":"//div[@class='scale']/*", | |
| "nextLink":"//span[@class='co-blk-b']/following-sibling::a[1]", | |
| "wedata.net.id":38709 | |
| }, | |
| { | |
| "url":"^http://www\\.papy\\.co\\.jp/(?:sc|act)/listc?/", | |
| "pageElement":"id('main')/*[preceding-sibling::div[starts-with(@style,'border-top')]][following-sibling::div[starts-with(@style,'border-top')] or self::h2]", | |
| "nextLink":"//a[starts-with(normalize-space(.),'次の')]", | |
| "wedata.net.id":77739 | |
| }, | |
| { | |
| "url":"^https?://commons\\.nicovideo\\.jp/user/upload/", | |
| "pageElement":"id(\"index_content\")//tr[contains(@id,\"material_\")]", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":2232 | |
| }, | |
| { | |
| "url":"^http://web\\.doujindou\\.com/(?:category|new)/", | |
| "pageElement":"id(\"category\")/div[@class=\"line550-g\" or @class=\"list4\"]", | |
| "nextLink":"id(\"category\")/div[@class=\"bottom-navi\" or @class=\"list_pager\"]//a[contains(., \"\u6b21\")]", | |
| "wedata.net.id":27093 | |
| }, | |
| { | |
| "url":"^https://www\\.azone-int\\.jp/azonet/list\\.jsp", | |
| "pageElement":"//table//div[@align='center']/table/tbody/tr", | |
| "nextLink":"//a[contains(.,'次のページ')]", | |
| "wedata.net.id":64787 | |
| }, | |
| { | |
| "url":"^http://takagi-hiromitsu\\.jp/diary/\\d+\\.html", | |
| "pageElement":"//div[@class=\"day\"]", | |
| "nextLink":"//div[@class=\"adminmenu\"]/span/a[contains(text(),\"\u524d\u306e\u65e5\u8a18\")]", | |
| "wedata.net.id":33047 | |
| }, | |
| { | |
| "url":"^http://www\\.jsports\\.co\\.jp/press/article/", | |
| "pageElement":"//div[@class='articleBody']/p", | |
| "nextLink":"//a[text()='次のページへ']", | |
| "wedata.net.id":76400 | |
| }, | |
| { | |
| "url":"^http://www\\.telechargementz-streaming\\.info", | |
| "pageElement":"//div[@class='custom-post']", | |
| "nextLink":"//div[@class='navigation']/a[last()][not(number()>0)]", | |
| "wedata.net.id":77208 | |
| }, | |
| { | |
| "url":"^http://(?:d|[^.]+\\.g)\\.hatena\\.ne\\.jp/bbs", | |
| "pageElement":"id(\"bbs\")", | |
| "nextLink":"//div[@class=\"bbsentrynext\"]/a", | |
| "wedata.net.id":54196 | |
| }, | |
| { | |
| "url":"^https://rdatatool.rms.rakuten.co.jp/rdreport/", | |
| "insertBefore":"/html/body/hr[last()]", | |
| "pageElement":"//font[contains(@color,\"#006600\") or contains(@color,\"#006600\")]/ancestor::table[1]", | |
| "nextLink":"//b/following-sibling::a", | |
| "wedata.net.id":80796 | |
| }, | |
| { | |
| "url":"^http://patft\\.uspto\\.gov/netacgi/nph-Parser", | |
| "pageElement":"//body/coma/center/following-sibling::node()[following-sibling::center/b='* * * * *']", | |
| "nextLink":"//a[img/@alt='[NEXT_DOC]']", | |
| "wedata.net.id":76384 | |
| }, | |
| { | |
| "url":"^http://www\\.nihonbungeisha\\.co\\.jp/search/", | |
| "pageElement":"id('search_list_tbl')//tr", | |
| "nextLink":"//a[@class='number next']", | |
| "wedata.net.id":63193 | |
| }, | |
| { | |
| "url":"^http://gyao\\.yahoo\\.co\\.jp/ranking/(?!all)", | |
| "pageElement":"//div[starts-with(@id,'mainCon')]", | |
| "nextLink":"//div[@class='pagingRank']/p/em/following-sibling::a", | |
| "wedata.net.id":65469 | |
| }, | |
| { | |
| "url":"^http://maouyusya2828\\.web\\.fc2\\.com/matome", | |
| "pageElement":"id('container')/*", | |
| "nextLink":"id('footer')/ul/li/a[contains(.,'NEXT')]", | |
| "wedata.net.id":32522 | |
| }, | |
| { | |
| "url":"^http://motorshow\\.carview\\.yahoo\\.co\\.jp/", | |
| "pageElement":"//div[@class=\"unGlMainPhoto\"]|//div[contains(concat(\" \",@class,\" \"),\" mdCntTitle \")]/following-sibling::div[1]", | |
| "nextLink":"//span[@class=\"arPhoto-next\"]/a", | |
| "wedata.net.id":77780 | |
| }, | |
| { | |
| "url":"^http://www\\.tenki\\.jp/.+/earthquake/entries", | |
| "pageElement":"id('earthquake_recent_entries_table')//tr[td]", | |
| "nextLink":"//a[@class='move_next_link']", | |
| "wedata.net.id":47556 | |
| }, | |
| { | |
| "url":"^http://www\\.iamboredoftheinternet\\.co\\.uk/", | |
| "pageElement":"id('content')/article/*[self::header or self::div]", | |
| "nextLink":"//div[@class='nav-next']/a", | |
| "wedata.net.id":77201 | |
| }, | |
| { | |
| "url":"^http://yubnub\\.org/kernel/most_used_commands", | |
| "pageElement":"//h1/following-sibling::br[1]/following-sibling::*[following-sibling::center]", | |
| "nextLink":"//a[b='Next Page']", | |
| "wedata.net.id":74327 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?stock-(?:chart|life)\\.net/", | |
| "pageElement":"//center[./table/colgroup][1]/following-sibling::center[following-sibling::center[./hr]]|//center[.//a[@title=\"next page\" or @title=\"first page\"]][1]/following-sibling::center[following-sibling::center//a[@title=\"next page\" or @title=\"first page\"]]", | |
| "nextLink":"//center/table[colgroup]/tbody/tr/td[last()]/b/a|//a[@title=\"next page\"]", | |
| "wedata.net.id":55430 | |
| }, | |
| { | |
| "url":"^http://blog\\.hatena\\.ne\\.jp/-/store/theme/", | |
| "pageElement":"id('main')/ul/li", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":76463 | |
| }, | |
| { | |
| "url":"^http://www\\.atmarkit\\.co\\.jp/ait/articles/", | |
| "pageElement":"//div[@id=\"col300c\"]/*[not(@id=\"cap-r\")]|//div[@id=\"col300c\"]/*[@id=\"cap-r\"][not(./strong)]|id(\"cmsAbstract\")|id(\"cmsTitle\")//big", | |
| "nextLink":"//div[@class=\"trBoxL\"]//a[./strong]", | |
| "wedata.net.id":77045 | |
| }, | |
| { | |
| "url":"^http://anbox\\.hinami\\.net/ngg/ngg.+\\.html$", | |
| "pageElement":"//center/p[2]", | |
| "nextLink":"//form/a[last()]", | |
| "wedata.net.id":72729 | |
| }, | |
| { | |
| "url":"https://tw\\.search\\.buy\\.yahoo\\.com/search", | |
| "pageElement":"id('srp_result_list')/*", | |
| "nextLink":"//li[contains(@class,'next-page')]/a", | |
| "wedata.net.id":49408 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?wincustomize\\.com/explore/", | |
| "pageElement":"//div[contains(concat(\" \", @class, \" \"), \" explore_listing \")]", | |
| "nextLink":"//a[contains(concat(\" \", @class, \" \"), \" pnext \")]", | |
| "wedata.net.id":32449 | |
| }, | |
| { | |
| "url":"^http://blogs\\.adobe\\.com/indesignchannel/.+", | |
| "pageElement":"id('container')", | |
| "nextLink":"/html/head/link[@rel='next']", | |
| "wedata.net.id":77841 | |
| }, | |
| { | |
| "url":"^http://r\\.gnavi\\.co\\.jp/g-interview/entry/", | |
| "pageElement":"(//div[@class=\"entry-content\"]/h3[last()-1]/preceding-sibling::*|//header[@class=\"entry-header\"])[//meta[@content=\"田中圭一\"]]", | |
| "nextLink":"//div[@class=\"entry-content\"]/p[last()]/cite/a|//div[@class=\"entry-content\"]/p[last()]/a[not(@href=\"http://r.gnavi.co.jp/g-interview/entry/1630\")]", | |
| "wedata.net.id":80920 | |
| }, | |
| { | |
| "url":"^http://www\\.sexyandfunny\\.com/image_gallery", | |
| "pageElement":"//img[starts-with(@src,\"http://files.sexyandfunny.com\")]", | |
| "nextLink":"//div[@class=\"next\"]/a | //img[starts-with(@src,\"http://www.sexyandfunny.com/images/nextphoto.png\")]/parent::a", | |
| "wedata.net.id":65543 | |
| }, | |
| { | |
| "url":"^http://www\\.mod\\.go\\.jp/pco/okayama/comic/", | |
| "pageElement":"id(\"content_2nd\")/*[preceding-sibling::h3][following-sibling::center]", | |
| "nextLink":"id(\"content_2nd\")/center/a[img/@src=\"../common/tugi.jpg\"]", | |
| "wedata.net.id":55903 | |
| }, | |
| { | |
| "url":"^http://chiebukuro\\.travel\\.yahoo\\.co\\.jp/", | |
| "pageElement":"//div[@class=\"ytrvKlgQstn\"]|//ul[@class=\"ytrvKlgDetailAns\"]", | |
| "nextLink":"//li[@class=\"next\"]/a", | |
| "wedata.net.id":28050 | |
| }, | |
| { | |
| "url":"^https?://best-times\\.jp/(articles|category)/", | |
| "pageElement":"//div[@class='article-body']/div[@class='pagination']/preceding-sibling::*[not(div/@id='next-page')]|//div[@class='article-list']/ul/li", | |
| "nextLink":"//span[@class='next']/a", | |
| "wedata.net.id":77847 | |
| }, | |
| { | |
| "url":"^http://.+\\.(riverfronttimes|sfweekly)\\.com/", | |
| "pageElement":"//div[@class='archiveListing clearfix']|id('searchResults')/*[h4]|//div[contains(@id,'storyBody')]/*[not(@class='pageNumber' or @class='content_insert' or @class='storyPagination')]", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":74928 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?glendenny\\.com/Portfolios/", | |
| "pageElement":"//div[contains(@id,\"portfolio_image\")]//img|id(\"imagecaption\")/*", | |
| "nextLink":"id('arrows')//a[contains(.,'>')] ", | |
| "wedata.net.id":25672 | |
| }, | |
| { | |
| "url":"^http://sports\\.yahoo\\.co.jp/(column|sports)", | |
| "pageElement":"//*[@class=\"mod-content\" or @class=\"newsList\" or @class=\"modBody\"]", | |
| "nextLink":"//a[(text()=\"次へ\") or (text()=\"次 »\")]", | |
| "wedata.net.id":76259 | |
| }, | |
| { | |
| "url":"^http://shop\\.tsutaya\\.co\\.jp/search_result", | |
| "pageElement":"id(\"area0\")", | |
| "nextLink":"//div[@class=\"tolNum\"]/following-sibling::ul/li[child::em]/following-sibling::li/a", | |
| "wedata.net.id":64777 | |
| }, | |
| { | |
| "url":"^https://syosetu\\.org/\\?mode=review&nid=\\d+", | |
| "pageElement":"//div[@class='section3']|//div[@class='section3']/following-sibling::br[1]", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":80568 | |
| }, | |
| { | |
| "url":"^http://www.goodsmile.info/[^/]+/products/page", | |
| "pageElement":"//div[@class='hitList clearfix']/div", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":25699 | |
| }, | |
| { | |
| "url":"^http://shop\\.fujiya-peko\\.co\\.jp/b/fujiya/", | |
| "pageElement":"//table[@class=\"MapiTable\"]//tr[@id]", | |
| "nextLink":"id(\"m_nextpage_link\")", | |
| "wedata.net.id":29316 | |
| }, | |
| { | |
| "url":"^https://vg\\.xpg\\.jp/deck/deck_search\\.fcgi", | |
| "pageElement":"//table[@class='jHover c2 dl f9']//tr[td]", | |
| "nextLink":"//span[@class='s s2']/following-sibling::a[1]", | |
| "wedata.net.id":76336 | |
| }, | |
| { | |
| "url":"^http://www\\.ftchinese\\.com/(story|channel)/", | |
| "pageElement":"//div[@class='pagination']/preceding-sibling::*", | |
| "nextLink":"//span[@class='current']/following-sibling::a[number()>0][1]", | |
| "wedata.net.id":25739 | |
| }, | |
| { | |
| "url":"^http://cherrypetal32\\.web\\.fc2\\.com/comic/", | |
| "pageElement":"//p", | |
| "nextLink":"//table//td[1]/a[img] | //span/b/span/a", | |
| "wedata.net.id":54460 | |
| }, | |
| { | |
| "url":"^http://www\\.posemaniacs\\.com/blog/category/", | |
| "pageElement":"//ul[@class='list']/li", | |
| "nextLink":"//a[@class='nextpostslink']", | |
| "wedata.net.id":63995 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?hb-nippon\\.com/(.+)/photo/", | |
| "pageElement":"//div[@class=\"photo\"][./div[@class=\"caption\"]]|id(\"gallery-photo\")/*", | |
| "nextLink":"//a[@class=\"next\"]", | |
| "wedata.net.id":77533 | |
| }, | |
| { | |
| "url":"^http://ebookstore\\.sony\\.jp/(author|search)", | |
| "pageElement":"//div[@class='img-result-block clearfix']/*", | |
| "nextLink":"//a[contains(concat(' ', @class, ' '), ' prev ') and img/@alt='次へ']", | |
| "wedata.net.id":41778 | |
| }, | |
| { | |
| "url":"^http://www\\.shopping-charm\\.jp/Items\\.aspx", | |
| "pageElement":"//table[@class=\"dtlItemList\"]", | |
| "nextLink":"//span[@class=\"list_page\"]/span/following-sibling::*[1][self::a]", | |
| "wedata.net.id":77527 | |
| }, | |
| { | |
| "url":"^http://www\\.asahi\\.com/travel/rail/gallery/", | |
| "pageElement":"//div[@class=\"ImgCenter\"]", | |
| "nextLink":"//p[@class=\"Next\"]/a", | |
| "wedata.net.id":1692 | |
| }, | |
| { | |
| "url":"^http://tower\\.jp/article/(?:series|feature)/", | |
| "pageElement":"id('entryContent')/div/*[not(@class='atcl-pos-center')]rn", | |
| "nextLink":"//*[@class='listModel-atclContext']/li[contains(span,'次の')]//a", | |
| "wedata.net.id":76327 | |
| }, | |
| { | |
| "url":"^http://search\\.loco\\.yahoo\\.co\\.jp/search", | |
| "pageElement":"//div[@class='LSaj cf']", | |
| "nextLink":"//a[span='>']", | |
| "wedata.net.id":1961 | |
| }, | |
| { | |
| "url":"^http://engwork\\.web\\.fc2\\.com/img/zel\\d+/", | |
| "pageElement":"//center/a[1]/preceding-sibling::*", | |
| "nextLink":"//a[img]", | |
| "wedata.net.id":39988 | |
| }, | |
| { | |
| "url":"^http://www\\.furanskin\\.net/([?]paged=\\d+)?", | |
| "pageElement":"//div[@id=\"content\"]/div[@class=\"datewhole\"]", | |
| "nextLink":"//div[@class=\"pagination\"]/a[contains(text(), \"›\")]", | |
| "wedata.net.id":76324 | |
| }, | |
| { | |
| "url":"^https://www\\.microsoft\\.com/[^/]+/research/", | |
| "pageElement":"//div[@class=\"ms-row\"]/article", | |
| "nextLink":"//a[@class=\"next page-numbers\"]", | |
| "wedata.net.id":80975 | |
| }, | |
| { | |
| "url":"^http://www\\.lettuceclub\\.net/recipe/search/", | |
| "pageElement":"id('searchList')/li", | |
| "nextLink":"//span[b/@class='current']/following-sibling::span[1]/a", | |
| "wedata.net.id":34066 | |
| }, | |
| { | |
| "url":"^http://www.soccermagazine-zone\\.com/archives", | |
| "pageElement":"//div[@class='post_content']/*", | |
| "nextLink":"id('post_pagenation')/span/following-sibling::a[1]", | |
| "wedata.net.id":74754 | |
| }, | |
| { | |
| "url":"^http://search\\.rakuten\\.co\\.jp/search/mall", | |
| "pageElement":"id('ratArea')/div | id('rsrWSArea')/div[starts-with(@class,'rsrWSSect')]", | |
| "nextLink":"//div[@class='nextPage']/a", | |
| "wedata.net.id":55733 | |
| }, | |
| { | |
| "url":"^http://t-walker\\.jp/eb/illust/ils_list\\.cgi", | |
| "pageElement":"//div[contains(concat(\" \", @class, \" \"), \" main \")]/table/tbody/tr[position() > 3]", | |
| "nextLink":"//div[contains(concat(\" \", @class, \" \"), \" main \")]/div/text()[contains(., \"\u3010\")]/following-sibling::a[1]", | |
| "wedata.net.id":39333 | |
| }, | |
| { | |
| "url":"^http://www\\.asahi\\.com/.*/gallery/.*\\.html", | |
| "pageElement":"//div[@class=\"ImgCenter\"]", | |
| "nextLink":"//p[@class=\"Next\"]/a", | |
| "wedata.net.id":39334 | |
| }, | |
| { | |
| "url":"^http://www\\.comshop\\.ne\\.jp/category-\\d+/", | |
| "pageElement":"//div[@class='pub_main_contents_chld_base']", | |
| "nextLink":"id('pub_main_contents')/form/div[@class='pub_main_sort']//span[not(a)]/following-sibling::span/a", | |
| "wedata.net.id":39336 | |
| }, | |
| { | |
| "url":"^http://www\\.chuo-u\\.ac\\.jp/(?:news|event)/", | |
| "pageElement":"//table[@class='line_news']//tr", | |
| "nextLink":"//a[@class='next page-numbers']", | |
| "wedata.net.id":739 | |
| }, | |
| { | |
| "url":"^http://www\\.sandiegouniontribune\\.com/news/", | |
| "pageElement":"//section[@class='row group']/article[starts-with(@class,'story_list')]", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":79973 | |
| }, | |
| { | |
| "url":"^https?://(?:www\\.)?photolibrary\\.jp/search/", | |
| "pageElement":"//ul[@class='pList pListLarge']/li[.//@class='photo']", | |
| "nextLink":"//span[@class='next']//a", | |
| "wedata.net.id":26590 | |
| }, | |
| { | |
| "url":"^http://nagomiweb\\.jp/cgi-bin/search\\.cgi\\?", | |
| "pageElement":"//table[@class=\"goodslist\"]", | |
| "nextLink":"//td[@class=\"next\"]/a", | |
| "wedata.net.id":26595 | |
| }, | |
| { | |
| "url":"^http://(?:[^./]+\\.)?antenam\\.(biz|info|jp)/", | |
| "pageElement":"id('main')/table//tr", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":74478 | |
| }, | |
| { | |
| "url":"^https://www\\.xiami\\.com/space/albums-update", | |
| "pageElement":"/html/body/div[@id='page']/div[@id='wrapper']/table[@id='albums_update']", | |
| "nextLink":"//a[@class=\"p_redirect_l\"]", | |
| "wedata.net.id":73787 | |
| }, | |
| { | |
| "url":"^http://tower\\.jp/blog/(tower-eco|intoxicate)", | |
| "pageElement":"//div[@class='topModuleBox']/div[@class='blogAtcl' or (starts-with(@class,'inMdl-atclHeadlineDefCell') and ..//@id='searchPaginationFooter')]|//div[@class='blogAtclBox']//div[@class='inMdl-atclDetailTitle' or @class='inMdl-atclDetailDate' or @class='inMdl-atclTextbody']", | |
| "nextLink":"//p[@class='nextLink']/a[contains(@href,'tower-eco') or contains(@href,'intoxicate')]|id('panelayout_1_maincolumn_1_BlogEntryLink')/dd[1]/a", | |
| "wedata.net.id":76302 | |
| }, | |
| { | |
| "url":"^http://blog\\.moccori\\.com/(?:$|index\\.php)", | |
| "pageElement":"//div[@class='container']/article", | |
| "nextLink":"//a[(text()='Next >>')]", | |
| "wedata.net.id":1608 | |
| }, | |
| { | |
| "url":"^http://search-sitenaviplus2\\.fresheye\\.com/", | |
| "pageElement":"//div[@class=\"search-list\"]//li", | |
| "nextLink":"//span[@class=\"pager\"]/em[last()]/a", | |
| "wedata.net.id":65632 | |
| }, | |
| { | |
| "url":"^http://www\\.ikea\\.com/(?:\\w\\w/){2}search/", | |
| "pageElement":"id(\"productsTable\")/tbody/tr|//div[@class=\"adsContainer\"]", | |
| "nextLink":"//a[@class=\"active\"]/following-sibling::a[position()=1 and not(contains(., \"Show all\"))]", | |
| "wedata.net.id":30887 | |
| }, | |
| { | |
| "url":"^http://(www\\.)?nikkan-gendai\\.com/articles/", | |
| "pageElement":"//p[@class=\"full-text\"]|//div[@class=\"article-wrap\"]//li[@class=\"article-box\"]", | |
| "nextLink":"//main/div[@class=\"paging-box\"]/p[@class=\"page-next\"]/a", | |
| "wedata.net.id":74818 | |
| }, | |
| { | |
| "url":"^http://t-walker\\.jp/eb/illust/prd_list\\.cgi", | |
| "pageElement":"//table[@class='padding3']/tbody/tr|//table[@class='border padding0 margin0']", | |
| "nextLink":"//div[@class='main' or @class='main670'][1]/descendant-or-self::text()[contains(.,'】')]/following-sibling::a[1]", | |
| "wedata.net.id":39337 | |
| }, | |
| { | |
| "url":"^http://www\\.bh-recipe\\.jp/recipe/list\\.php", | |
| "pageElement":"//td[@class='contents']/table/tbody/tr[th]/following-sibling::tr", | |
| "nextLink":"//td[@class='contents']/table[last()]//a[starts-with(.,'次の')]", | |
| "wedata.net.id":1574 | |
| }, | |
| { | |
| "url":"^http://k-tai\\.impress\\.co\\.jp/img/.+/html/", | |
| "pageElement":"//table[contains(concat(\" \", @class, \" \"), \" image_table \")] | //*[@id=\"main-image-wrap\"]", | |
| "nextLink":"//td[@class=\"paging_right_cell\"]/a | //a[@class=\"next\"]", | |
| "wedata.net.id":39344 | |
| }, | |
| { | |
| "url":"^http://www\\.geocities\\.jp/timeway/(?!html)", | |
| "pageElement":"//div[@align='right']/following-sibling::table[@border=\"0\"]", | |
| "nextLink":"//a[contains(.,'次のページへ')]", | |
| "wedata.net.id":65601 | |
| }, | |
| { | |
| "url":"^http://book(\\.akahoshitakuya|meter)\\.com/b", | |
| "pageElement":"//div[@class=\"log_list_box hreview\"]", | |
| "nextLink":"//span[@class='now_page']/following-sibling::span[1]/a", | |
| "wedata.net.id":33127 | |
| }, | |
| { | |
| "url":"^http://giraffe\\.iseteki\\.net/applis/search", | |
| "pageElement":"//dl[contains(@class, \"section\")]", | |
| "nextLink":"//div[@class=\"pageBrowser\"]/p[1]/a[contains(text(), \"\u6b21\u306e\u30da\u30fc\u30b8\uff1e\")]", | |
| "wedata.net.id":1959 | |
| }, | |
| { | |
| "url":"^https?://forums\\.whirlpool\\.net\\.au/forum", | |
| "pageElement":"//table[@class='showvisited']/tbody/tr|id('replylist')/div", | |
| "nextLink":"(id('threads')/div[@class='footbar']/ul[@class='pagination']|id('top_pagination'))/li[starts-with(@class,'current')]/following-sibling::li[1]/a", | |
| "wedata.net.id":32966 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?myepisodes\\.com/cal\\.php", | |
| "pageElement":"//table[@class=\"cal_container\"]", | |
| "nextLink":"id(\"calendar\")//td[@class=\"cal_navi_right\"]/a", | |
| "wedata.net.id":32960 | |
| }, | |
| { | |
| "url":"^http://www\\.hummingheads\\.co\\.jp/reports/", | |
| "pageElement":"id('column')/*", | |
| "nextLink":"//p[@class='ct']/a", | |
| "wedata.net.id":79949 | |
| }, | |
| { | |
| "url":"^http://forum\\.wincmd\\.ru/viewtopic\\.php.+", | |
| "pageElement":"//table[@class='forumline']/tbody/tr[td/span[@class='postdetails']]", | |
| "nextLink":"//span[@class='gensmall']//b/following-sibling::a[1]", | |
| "wedata.net.id":77842 | |
| }, | |
| { | |
| "url":"^http://www\\.ici-webshop\\.com/products/list", | |
| "pageElement":"//div[@class='list_area clearfix']", | |
| "nextLink":"//div[@class='navi']/strong/following-sibling::a[1]", | |
| "wedata.net.id":55840 | |
| }, | |
| { | |
| "url":"^http://news\\.livedoor\\.com/article/detail/", | |
| "pageElement":"//ul[@class='pager']/preceding-sibling::node()|//figure[@class='articleImage']", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":2125 | |
| }, | |
| { | |
| "url":"^http://brokenstones\\.(?:me|cn)/browse\\.php", | |
| "pageElement":"//table[@class=\"borderinterior\"]", | |
| "nextLink":"//table[@class=\"borderinterior\"]/following-sibling::p/a/b[contains(text(),\"Next\")]/parent::a", | |
| "wedata.net.id":2277 | |
| }, | |
| { | |
| "url":"^http://www\\.codeproject\\.com/search\\.aspx", | |
| "pageElement":"//div[@class=\"content-list\"]", | |
| "nextLink":"//a[(text()=\"Next\")]", | |
| "wedata.net.id":72601 | |
| }, | |
| { | |
| "url":"^http://henachyocorone\\.blog112\\.fc2\\.com/", | |
| "pageElement":"//div[@class='section'][position()>1]", | |
| "nextLink":"//a[@title='次頁へ移動する']", | |
| "wedata.net.id":38804 | |
| }, | |
| { | |
| "url":"^http://oldgamebox\\.tistory\\.com/category/*", | |
| "pageElement":"//div[@id='searchList' and @class='nonEntry']/ol/li", | |
| "nextLink":"//a[@id='nextPage' and contains(text(),'다음')]", | |
| "wedata.net.id":74710 | |
| }, | |
| { | |
| "url":"^https?://www\\.amazon\\.co\\.jp/gp/yourstore", | |
| "pageElement":"//div[@class=\"ys\"]", | |
| "nextLink":"id(\"ysMoreResults\")/parent::a", | |
| "wedata.net.id":417 | |
| }, | |
| { | |
| "url":"^http://(mulele\\.com/comics/|jessfink\\.com)", | |
| "pageElement":"id('comic')", | |
| "nextLink":"//div[@class='nav']/a[last()]", | |
| "wedata.net.id":2368 | |
| }, | |
| { | |
| "url":"^https?://(?:d|[^.]+\\.g)\\.hatena\\.ne\\.jp/", | |
| "pageElement":"id(\"days\")/div", | |
| "nextLink":"//a[@rel='prev']", | |
| "wedata.net.id":700 | |
| }, | |
| { | |
| "url":"^http://www\\.pi-kun\\.com/(?!archives/\\d+$)", | |
| "pageElement":"//div[@class='top-contents']/ul|id('main')/article", | |
| "nextLink":"//div[@class='next']/a[//div/@class='top-contents']|//div[@class='prev']/a[id('main')/article]", | |
| "wedata.net.id":1777 | |
| }, | |
| { | |
| "url":"^http://counter\\.hatena\\.ne\\.jp/.+?/log\\?", | |
| "insertBefore":"//div[@class=\"pager\"][last()]", | |
| "pageElement":"id(\"log_table\")", | |
| "nextLink":"//div[@class=\"pager\"][last()]/a[last()]", | |
| "wedata.net.id":705 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?anandtech\\.com/show/\\d+/", | |
| "pageElement":"//div[@class='articleContent']/*", | |
| "nextLink":"//a[@class='fl-rt']", | |
| "wedata.net.id":32053 | |
| }, | |
| { | |
| "url":"^http://www\\.webdoku\\.jp/rensai/sakka/michi", | |
| "pageElement":"//div[@class=\"entry-content\"]|id(\"sakka\")|id(\"sakka-header\")[.//p[contains(@class,\"date\")]]", | |
| "nextLink":"//p[contains(@class,\"contentNavi\")]/a[1]", | |
| "wedata.net.id":76697 | |
| }, | |
| { | |
| "url":"^http://(?:hirame|mup|sukima)\\.vip2ch\\.com/", | |
| "pageElement":"id('samlist')/tbody/tr", | |
| "nextLink":"id('nextbutton')", | |
| "wedata.net.id":28365 | |
| }, | |
| { | |
| "url":"^http://vipvipblogblog\\.blog119\\.fc2\\.com/", | |
| "pageElement":"//div[@class='entry_block']", | |
| "nextLink":"//a[@title='次のページへ進む']", | |
| "wedata.net.id":1770 | |
| }, | |
| { | |
| "url":"^http://www\\.bikebros\\.co\\.jp/bikesearch2/", | |
| "pageElement":"//div[@class='listview']", | |
| "nextLink":"//a[@class='next page-numbers']", | |
| "wedata.net.id":64252 | |
| }, | |
| { | |
| "url":"^http://impre\\.net/php/impre/impreshow\\.php", | |
| "pageElement":"//div[@align=\"center\"][.//td[@class=\"PageLinkImpre\"]][1]/following-sibling::div[@align=\"center\"][1]/following-sibling::*[following-sibling::div[@align=\"center\"][.//td[@class=\"PageLinkImpre\"]]]", | |
| "nextLink":"//td[@class=\"PageLinkImpre\"][not(./a[1]/@href=./a[last()]/@href) or ./a[last()][contains(@href,\"&pgg=2\")]]/a[last()]", | |
| "wedata.net.id":2876 | |
| }, | |
| { | |
| "url":"^https://(habrahabr|geektimes|megamozg)\\.ru/", | |
| "pageElement":"//div[@class='posts shortcuts_items']/div", | |
| "nextLink":"id('next_page')", | |
| "wedata.net.id":31614 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.|directory\\.)?xogogo\\.com/", | |
| "pageElement":"//div[contains(concat(' ', @class, ' '), ' VidSpot ')]", | |
| "nextLink":"//div[contains(concat(' ', @class, ' '), ' PageNation ')]//a[contains(concat(' ', @class, ' '), ' pagerlink ') and .='>']", | |
| "wedata.net.id":62055 | |
| }, | |
| { | |
| "url":"^http://(www\\.)?(gamers-review|psmk2)\\.net/", | |
| "pageElement":"//div[@class='reviewlist']//tr[td]", | |
| "nextLink":"//li[@class='pagelink_next']/a|//li[@class='page selected']/following-sibling::li[1]/a", | |
| "wedata.net.id":73775 | |
| }, | |
| { | |
| "url":"^http://www\\.milliyet\\.com\\.tr/fotogaleri/", | |
| "pageElement":"//td[@class='pho']/div[not(@class='pagerBottom')]", | |
| "nextLink":"//li[span/@class='slctd']/following-sibling::li/a", | |
| "wedata.net.id":76842 | |
| }, | |
| { | |
| "url":"^http://store\\.americanapparel\\.net/search/", | |
| "pageElement":"//ul[@class='productGroup col-3']/li", | |
| "nextLink":"//a[span/@class='pagn-next']", | |
| "wedata.net.id":31281 | |
| }, | |
| { | |
| "url":"^http://www\\.allnightnippon\\.com/gold/\\w+/", | |
| "pageElement":"id('inner_box')", | |
| "nextLink":"//li[@class='next_btn']/a", | |
| "wedata.net.id":31172 | |
| }, | |
| { | |
| "url":"^http://imihu\\.blog30\\.fc2\\.com/(?:$|page)", | |
| "pageElement":"//div[@class=\"left\"]/*[self::h3 or self::div[@class=\"body\"]]", | |
| "nextLink":"//a[contains(text(), \"\u6b21\u306e\u30da\u30fc\u30b8\")]", | |
| "wedata.net.id":26176 | |
| }, | |
| { | |
| "url":"^http://r\\.gnavi\\.co\\.jp/headline/g-trend/", | |
| "pageElement":"//div[@class=\"section gheadLine cx\"]", | |
| "nextLink":"id('localNav')/li[@class='active']/following-sibling::li[1]/a", | |
| "wedata.net.id":77502 | |
| }, | |
| { | |
| "url":"^http://blog\\.goo\\.ne\\.jp/coordinator_2005", | |
| "pageElement":"//div[@class='mod-entry-set']", | |
| "nextLink":"//a[span/@class='etNextPrev']", | |
| "wedata.net.id":31095 | |
| }, | |
| { | |
| "url":"^http://sozaijiten\\.net/search/search\\.aspx", | |
| "pageElement":"//div[@class=\"thumbnailArea\"]/div[@class=\"thumbnail\"]", | |
| "nextLink":"//div[@class=\"pagelink\"]/b/following-sibling::a", | |
| "wedata.net.id":77491 | |
| }, | |
| { | |
| "url":"^https?://what\\.cd/(?:collages|forums)\\.php", | |
| "pageElement":"//div[@class='thin']/table", | |
| "nextLink":"//a[@class='pager_next']", | |
| "wedata.net.id":73781 | |
| }, | |
| { | |
| "url":"^http://xn--t8jg1hce67da3680ddrbu39u09e\\.com", | |
| "pageElement":"//div[@class=\"box_in\"]/p", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":46148 | |
| }, | |
| { | |
| "url":"^http://coolier\\.sytes\\.net:8080/sosowa/.+/", | |
| "pageElement":"//tr[@class='tags' or @class='article']", | |
| "nextLink":"//li[a/@class='active']/following-sibling::li[1]/a", | |
| "wedata.net.id":37596 | |
| }, | |
| { | |
| "url":"^http://music\\.j-total\\.net/db/search\\.cgi", | |
| "pageElement":"//form/table", | |
| "nextLink":"//center/a[.='次ページ→']", | |
| "wedata.net.id":26914 | |
| }, | |
| { | |
| "url":"^http://profile\\.livedoor\\.com/[^/]+/friend", | |
| "pageElement":"id(\"friendList\")", | |
| "nextLink":"//li[@class=\"next\"]/a", | |
| "wedata.net.id":30230 | |
| }, | |
| { | |
| "url":"^http://(?:[^.]+\\.)?imdb\\.com/mymovies/list", | |
| "pageElement":"//tr[td[1][@valign=\"middle\"]][td[2][@class=\"standard\"]]", | |
| "nextLink":"//td[@class=\"standard\"][@align=\"right\"]/a[text()=\"Next\"]", | |
| "wedata.net.id":30222 | |
| }, | |
| { | |
| "url":"^https?://www\\.flickr\\.com/photos/[^/]+/\\d", | |
| "pageElement":"//div[@class='view photo-well-scrappy-view']", | |
| "nextLink":"//a[@class='navigate-target navigate-next']", | |
| "wedata.net.id":29787 | |
| }, | |
| { | |
| "url":"^http://seiga\\.nicovideo\\.jp/my/personalize", | |
| "pageElement":"id('my_personalize')", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":77424 | |
| }, | |
| { | |
| "url":"^http://natgeo\\.nikkeibp\\.co\\.jp/nng/news/", | |
| "pageElement":"id('newsListResult')//li", | |
| "nextLink":"//span[@class='next']/a", | |
| "wedata.net.id":35657 | |
| }, | |
| { | |
| "url":"^https://www\\.tabisland\\.ne\\.jp/smb-keiri/", | |
| "pageElement":"//*[@class='td2' or td/@class='td0']", | |
| "nextLink":"//a[img/@alt='次へ']", | |
| "wedata.net.id":74963 | |
| }, | |
| { | |
| "url":"^http://irumahitoma\\.jp/webnovel/novel\\d{3}", | |
| "pageElement":"//div[@class='noveltext']", | |
| "nextLink":"id('data_list')/div/a[contains(.,'>>')]", | |
| "wedata.net.id":55541 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?lahiguera\\.net/musicalia/", | |
| "pageElement":"//div[@align=\"center\"]//tr[./td[@class=\"normal1\"][not(./*)]][1]/following-sibling::tr|//div[@align=\"center\"]//tr[./td[@class=\"normal1\"][not(./*)]][1]", | |
| "nextLink":"//td[@class='enlace']/b/following-sibling::a[1]", | |
| "wedata.net.id":27495 | |
| }, | |
| { | |
| "url":"^http://www\\.comic-essay\\.com/episode/read/", | |
| "pageElement":"//div[@class=\"manga-imgs\"]|//div[@class=\"frame01 manga-page mt15\"]/div[@class=\"contents-head01 c-fix\"]", | |
| "nextLink":"//li[@class=\"next\"]/a", | |
| "wedata.net.id":80784 | |
| }, | |
| { | |
| "url":"^https://aur\\.archlinux\\.org/packages\\.php", | |
| "pageElement":"//table[@class='results']//tr[td]", | |
| "nextLink":"//a[@class='page'][.='Next ›']", | |
| "wedata.net.id":27985 | |
| }, | |
| { | |
| "url":"^https?://(.+)?(userstyles|greasyfork)\\.org/", | |
| "pageElement":"id('main-article')/article|id('browse-script-list')/li | id('Content')//ul[contains(@class,'DataList')]/li | id('Log')", | |
| "nextLink":"//a[@rel='next'] | id('PagerMore')/a", | |
| "wedata.net.id":74978 | |
| }, | |
| { | |
| "url":"^http://[^\\.]+\\.ufufugirls\\.jp(/[^\\?]*)?$", | |
| "pageElement":"//div[@class=\"entry\"]", | |
| "nextLink":"//span[@class=\"pager-right\"]/a", | |
| "wedata.net.id":62795 | |
| }, | |
| { | |
| "url":"^http://www\\.nikkeibp\\.co\\.jp/article/sj/", | |
| "pageElement":"id(\"primary\")//div[contains(@class, \"primary_leaf_body\")]", | |
| "nextLink":"id('primary')//a[descendant::*[text()=\"\u6b21\u3078\"]]", | |
| "wedata.net.id":28868 | |
| }, | |
| { | |
| "url":"^http://www\\.nijibox3\\.com/magical/futaba/", | |
| "insertBefore":"//form[1]/hr[last()]", | |
| "pageElement":"//form[1][@action=\"magical.php\"][contains(text(),\":\")]/*[not(self::table[contains(@align,\"right\")])]", | |
| "nextLink":"//form[contains(@action,\".htm\")][last()]", | |
| "wedata.net.id":29319 | |
| }, | |
| { | |
| "url":"^http://pornolab\\.net/forum/viewforum\\.php", | |
| "pageElement":"//table[@class=\"forumline forum\"]//tr[@id]", | |
| "nextLink":"id(\"pagination\")//a[last()][not(./following-sibling::b)]", | |
| "wedata.net.id":80776 | |
| }, | |
| { | |
| "url":"^http://news\\.infoseek\\.co\\.jp/article/.+", | |
| "pageElement":"//div[@class='topic-detail__text']/p/node()", | |
| "nextLink":"//a[img/@alt='次のページ']", | |
| "wedata.net.id":73950 | |
| }, | |
| { | |
| "url":"^http://search\\.travel\\.rakuten\\.co\\.jp/", | |
| "pageElement":"id(\"htlBox\")/li", | |
| "nextLink":"//li[@class=\"pagingBack\"]/a", | |
| "wedata.net.id":29455 | |
| }, | |
| { | |
| "url":"^http://(s|www)\\.inside-games\\.jp/article/", | |
| "pageElement":"//article[@class='arti-body js-arti-body' or @class='arti-body cf']", | |
| "nextLink":"//li[./span[contains(@class,\"current\")]]/following-sibling::li[1]/a", | |
| "wedata.net.id":77252 | |
| }, | |
| { | |
| "url":"^http://maoh\\.dengeki\\.com/(?:[^/]+/)?try/", | |
| "pageElement":"id(\"main main_950 main_970 main_980 main_1000 main1000\")/*", | |
| "nextLink":"(id(\"navi\")|//ul[@class=\"navi\"])/li[@class=\"next\"]/a | id(\"next try_next\")/a", | |
| "wedata.net.id":50187 | |
| }, | |
| { | |
| "url":"^http://orangestar\\.hatenadiary\\.jp/entry/", | |
| "pageElement":"//div[@class=\"entry-inner\"]/*[@class=\"entry-header\" or @class=\"entry-content\"]|//footer/div[@class=\"hatena-star-metadata\"]/preceding-sibling::*|//ul[@class=\"comment\"]", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":77293 | |
| }, | |
| { | |
| "url":"^http://keiba\\.radionikkei\\.jp/keiba/news/", | |
| "pageElement":"//div[@class='top_box_wrapper kjnet2']", | |
| "nextLink":"//div[@class='topics_navi']/a[contains(.,'次の')]", | |
| "wedata.net.id":29580 | |
| }, | |
| { | |
| "url":"^https?://(?:(?:www|sukebei?)\\.)?nyaa\\.se/", | |
| "pageElement":"//table[@class='tlist']/tbody/tr[td]", | |
| "nextLink":"//div[@class='pages']/b/following-sibling::a[1]", | |
| "wedata.net.id":27301 | |
| }, | |
| { | |
| "url":"^http://blog\\.wakakitamiki\\.coolblog\\.jp/", | |
| "pageElement":"id(\"contents\")/div", | |
| "nextLink":"id(\"contents\")/ul[@class=\"navi\"]//a[text()=\">>\"]", | |
| "wedata.net.id":27161 | |
| }, | |
| { | |
| "url":"^http://.+\\.tdk\\.co\\.jp/(techmag|search)/", | |
| "pageElement":"//td[@class='nvbg001']/following-sibling::td[2]/table[last()-1]/tbody/tr[td/@class='text']|id('SS_result')/*", | |
| "nextLink":"//a[contains(img/@src,'btn_next')]|//span[@class='SS_nextPage']/a", | |
| "wedata.net.id":52827 | |
| }, | |
| { | |
| "url":"^http://karada\\.goo\\.ne\\.jp/(diary|user)/", | |
| "pageElement":"id('hWrapper')/div[@class='marubox'][preceding-sibling::ul]", | |
| "nextLink":"//div[@class='paging']/span[@class='cur']/following-sibling::span[1]/a", | |
| "wedata.net.id":29584 | |
| }, | |
| { | |
| "url":"^http://www\\.iza\\.ne\\.jp/kiji/(.+)/photos", | |
| "pageElement":"//article[@class=\"photo-main\"]", | |
| "nextLink":"//div[@class=\"button-next\"]/a", | |
| "wedata.net.id":29654 | |
| }, | |
| { | |
| "url":"^http://news\\.infoseek\\.co\\.jp/publisher/", | |
| "pageElement":"//ul[@class=\"topics-list\"]/li", | |
| "nextLink":"//link[@rel=\"next\"]", | |
| "wedata.net.id":26956 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?bonom\\.lu/gags3\\.php\\?", | |
| "pageElement":"id(\"gag\")/img", | |
| "nextLink":"id(\"next_page_link\")[substring-before(substring-after(@href, \"num=\"), \"&\") != \"1\"]", | |
| "wedata.net.id":46281 | |
| }, | |
| { | |
| "url":"^http://www\\.skyarc\\.co\\.jp/engineerblog/", | |
| "pageElement":"//ul[@class='news-area-list']/li", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":30485 | |
| }, | |
| { | |
| "url":"^http://www\\.ventforet\\.jp/schedules/month", | |
| "pageElement":"//table[@class=\"list\"]//tr[./td]", | |
| "nextLink":"//div[@class=\"month-next\"]//a", | |
| "wedata.net.id":26843 | |
| }, | |
| { | |
| "url":"^http://www\\.afpbb\\.com/(category|search)/", | |
| "pageElement":"//div[@class='thumbBrock thumbBrockL']|id('main-column')/section/ul/li", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":55226 | |
| }, | |
| { | |
| "url":"^https?://search\\.morinaga\\.co\\.jp/search", | |
| "pageElement":"id('SS_result')/div", | |
| "nextLink":"//span[@class='SS_nextPage']/a", | |
| "wedata.net.id":57085 | |
| }, | |
| { | |
| "url":"^https://community\\.spotify\\.com/t5.*/td-p", | |
| "pageElement":"//div[@class='linear-message-list message-list']/*", | |
| "nextLink":"//ul[@class='lia-paging-full lia-paging-full-left']/li[@class='lia-paging-page-next lia-component-next']//a", | |
| "wedata.net.id":73780 | |
| }, | |
| { | |
| "url":"^http://(?:xera|moepic\\d?)\\.moe-ren\\.net/", | |
| "pageElement":"//div[@align=\"center\"]//table[@width=\"95%\"]", | |
| "nextLink":"//div[@id=\"_threads_link_\"]/table/tbody/tr/td/strong/following-sibling::a[1]", | |
| "wedata.net.id":759 | |
| }, | |
| { | |
| "url":"^http://www\\.sportsclick\\.jp/products/info", | |
| "pageElement":"//div[@class='info_box info_02']/dl", | |
| "nextLink":"//a[@class='link_next']", | |
| "wedata.net.id":63175 | |
| }, | |
| { | |
| "url":"^https?://code\\.google\\.com/hosting/search", | |
| "pageElement":"id('serp')//tr", | |
| "nextLink":"//a[(b='›')]", | |
| "wedata.net.id":476 | |
| }, | |
| { | |
| "url":"^http://sonico\\.info/delico/log/nicky\\.cgi", | |
| "pageElement":"id('mright')/*[@class='article' or self::br]", | |
| "nextLink":"//a[.='OLD >>']", | |
| "wedata.net.id":74656 | |
| }, | |
| { | |
| "url":"^http://www\\.tg-net\\.co\\.jp/ext/hn/story/", | |
| "pageElement":"//div[@class=\"section\"]/*[self::font or self::br]", | |
| "nextLink":"//a[contains(., \"次ページへ\")]", | |
| "wedata.net.id":74657 | |
| }, | |
| { | |
| "url":"^http://www\\.geocities\\.co\\.jp/MotorCity/", | |
| "pageElement":"//hr[2]/following-sibling::node()", | |
| "nextLink":"//a[contains(text(),\"次\")]", | |
| "wedata.net.id":62097 | |
| }, | |
| { | |
| "url":"^http://www\\.(kirainet|ageekinjapan)\\.com/", | |
| "pageElement":"//div[@class='post']|//article", | |
| "nextLink":"//div[@class='navigation']/div[@class='left' or @class='main']/a|//a[span/@class='arrow_carrot-right']", | |
| "wedata.net.id":31822 | |
| }, | |
| { | |
| "url":"^http://nationalgeographic\\.jp/nng/article/", | |
| "pageElement":"//div[@class=\"articleInner\"]/*[not(contains(@class,\"PageNav\"))]", | |
| "nextLink":"//a[@class=\"nextPage\"]", | |
| "wedata.net.id":62167 | |
| }, | |
| { | |
| "url":"^http://www\\.tel\\.co\\.jp/museum/magazine/", | |
| "pageElement":"id(\"wrap\")//div[contains(concat(\" \", @class, \" \"), \" article \")]/*[not(contains(concat(\" \", @class, \" \"), \" title \") or @id='pager')]", | |
| "nextLink":"id(\"pager\")//li[contains(concat(\" \", @class, \" \"), \" next \")]/a", | |
| "wedata.net.id":62281 | |
| }, | |
| { | |
| "url":"/index\\.php\\?(?:.+&)?action=history(?:&|$)", | |
| "pageElement":"id(\"pagehistory\")/li", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":2678 | |
| }, | |
| { | |
| "url":"^http://www\\.business-plus\\.net/.+\\.shtml", | |
| "pageElement":"//article/*", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":41395 | |
| }, | |
| { | |
| "url":"^http://ejje\\.weblio\\.jp/sentence/content/", | |
| "pageElement":"id(\"main\")//div[contains(concat(\" \", @class, \" \"), \" kiji \")]/div[contains(concat(\" \", @class, \" \"), \" qotC \")]", | |
| "nextLink":"id(\"main\")//div[contains(concat(\" \", @class, \" \"), \" kiji \")]/a[starts-with(text(), \"\u6b21\u3078\")]", | |
| "wedata.net.id":41315 | |
| }, | |
| { | |
| "url":"^http://nihonnagonago\\.blog115\\.fc2\\.com/", | |
| "pageElement":"//div[@class='entry_block']", | |
| "nextLink":"//div[@class='entry_navi']/a[last()]", | |
| "wedata.net.id":1771 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?textsfromlastnight\\.com/", | |
| "pageElement":"id(\"texts-list\")", | |
| "nextLink":"//li[@class=\"next\"]/a", | |
| "wedata.net.id":32037 | |
| }, | |
| { | |
| "url":"^http://(www\\.)?(mangastream|readms)\\.com/", | |
| "pageElement":"//div[@class='blog-post' or @class='page']", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":32317 | |
| }, | |
| { | |
| "url":"^http://(www|tel|cnc|en)\\.(1kkk|dm5)\\.com/", | |
| "pageElement":"//div[@id=\"index_left\"]//div[@class=\"innr3\"]|//div[@class=\"main\"]//ul[@class=\"in_01\"]", | |
| "nextLink":"//div[@id=\"search_fy\"]/a[.=\"下一页\"]", | |
| "wedata.net.id":80913 | |
| }, | |
| { | |
| "url":"^http://www\\.goobike\\.com/learn/bike_issue", | |
| "pageElement":"id(\"all\")", | |
| "nextLink":"id(\"footer_body\")/div[@class=\"footer_right\"]/span[@class=\"sj\"]/a", | |
| "wedata.net.id":77706 | |
| }, | |
| { | |
| "url":"^http://ro69\\.jp/(news|live|disc|blog|feat)", | |
| "pageElement":"//div[contains(@class,'article_list w')]/*|//ul[@class='disc_list jsTail jsSameHeight clearfix' or @class='blog_list']/li|//div[@class='article_box'][not(//nav/@class='pagination')]/div[@class='clearfix article_link_b']/preceding-sibling::*", | |
| "nextLink":"//li[span/@class='page_numbers current']/following-sibling::li[1]/a|//p[@class='right']/a", | |
| "wedata.net.id":76242 | |
| }, | |
| { | |
| "url":"^http://www\\.asukashinsha\\.co\\.jp/search/", | |
| "pageElement":"id(\"searchResult\")//div[@class=\"contents\"]", | |
| "nextLink":"//div[@class=\"paging\"]/a[contains(text(), \"次の\")]", | |
| "wedata.net.id":65447 | |
| }, | |
| { | |
| "url":"^http://www\\.mathworks\\.com/matlabcentral/", | |
| "pageElement":"//div[starts-with(normalize-space(@class),'row add_border_bottom')]|//tr[@class='file_results']", | |
| "nextLink":"//a[span/@class='icon-arrow-open-right']|id('pagination_next')", | |
| "wedata.net.id":32709 | |
| }, | |
| { | |
| "url":"^http://(www|forums)\\.somethingawful\\.com/", | |
| "pageElement":"//div[@class='organ article']/*|//tr[@class='thread']|//table[@class='post ']|//div[@class='organ search_results']//li", | |
| "nextLink":"//a[@title='Next page']|//li[@class='cur']/following-sibling::li[1]/a", | |
| "wedata.net.id":32717 | |
| }, | |
| { | |
| "url":"^http://www\\.1101\\.com/pl/131101treehouse/", | |
| "pageElement":"//div[@class='article']", | |
| "nextLink":"//a[contains(img/@src,'btn_back')]", | |
| "wedata.net.id":76252 | |
| }, | |
| { | |
| "url":"^http://(?:biz|news)\\.chosun\\.com/svc/list", | |
| "pageElement":"//dl[@class='list_item']", | |
| "nextLink":"//ul[@class='paginate_num']/li[a/@class='current']/following-sibling::li[1]/a", | |
| "wedata.net.id":54314 | |
| }, | |
| { | |
| "url":"^http://gununu\\.nipah\\.co\\.uk/post/list/?", | |
| "pageElement":"id(\" main\")/span[@class=\"thumb\"]", | |
| "nextLink":"id(\"paginator\")/a[text()=\">>\"]", | |
| "wedata.net.id":66482 | |
| }, | |
| { | |
| "url":"^http://4pda\\.ru/forum/index\\.php\\?show.+", | |
| "pageElement":"//table[@data-post and not(../@id='topic-pin-content')] | //table[@class='ipbtable']/tbody/tr[td[starts-with(@id,'tid-folder')]]", | |
| "nextLink":"//span[@class='pagecurrent']/following-sibling::span[1]/a", | |
| "wedata.net.id":77785 | |
| }, | |
| { | |
| "url":"^https://developer\\.mozilla\\.org/.+/search", | |
| "pageElement":"//ul[@class='result-list']/li", | |
| "nextLink":"id('search-result-next')", | |
| "wedata.net.id":2129 | |
| }, | |
| { | |
| "url":"^http://counter\\.hatena\\.ne\\.jp/imagelist", | |
| "insertBefore":"//table[@class=\"imagelist-table\"]//tr[last()]/following-sibling::node()", | |
| "pageElement":"//table[@class=\"imagelist-table\"]//tr[position() > 1]", | |
| "nextLink":"//div[@class=\"pager\"]/a[last()]", | |
| "wedata.net.id":40571 | |
| }, | |
| { | |
| "url":"https://www\\.asos\\.cn/my-account/wishlists", | |
| "pageElement":"id('your_wishlist')/tbody/tr[td]", | |
| "nextLink":"//ol[@class='pager']/li/a[contains(.,'前进')]", | |
| "wedata.net.id":74883 | |
| }, | |
| { | |
| "url":"^http://blog\\.parco-city\\.com/blog-across/", | |
| "pageElement":"//div[@class=\"entry-asset asset\"]", | |
| "nextLink":"//link[@rel=\"prev\"]", | |
| "wedata.net.id":2059 | |
| }, | |
| { | |
| "url":"http://www.haikanbuhin.com/top/(item|search)", | |
| "pageElement":"id('item_box')/*", | |
| "nextLink":"//li[@class='next']//a", | |
| "wedata.net.id":54442 | |
| }, | |
| { | |
| "url":"^http://(www\\.)?ewoman(\\.co)?\\.jp/winwin/", | |
| "pageElement":"id('ewContentsBody winwinDetail')//div[@class='indexList' or @class='box']", | |
| "nextLink":"//a[../@class='next']", | |
| "wedata.net.id":55839 | |
| }, | |
| { | |
| "url":"^http://auction\\.brandear\\.jp/search/list/", | |
| "pageElement":"id('result')/li", | |
| "nextLink":"//a[@title='next page']", | |
| "wedata.net.id":62911 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?pupie3d\\.com/search/list", | |
| "pageElement":"id(\"main\")/table", | |
| "nextLink":"//span[@class=\"next_page\"]/a", | |
| "wedata.net.id":70150 | |
| }, | |
| { | |
| "url":"^http://www\\.network54\\.com/Forum/\\d{5,6}", | |
| "pageElement":"//center/table[@width='94%']", | |
| "nextLink":"//a[.='Next Topic >>']", | |
| "wedata.net.id":64022 | |
| }, | |
| { | |
| "url":"http://bizgate\\.nikkei\\.co\\.jp/article/.+", | |
| "pageElement":"//div[@class=\"article-body-txt\"]", | |
| "nextLink":"//a[@class=\"link_next\"]", | |
| "wedata.net.id":74789 | |
| }, | |
| { | |
| "url":"^http://komigami\\.haru\\.gs/.+?/\\d+\\.html", | |
| "pageElement":"//a[img]", | |
| "nextLink":"//a[contains(.,'→') and not(contains(@href,'#'))]", | |
| "wedata.net.id":39989 | |
| }, | |
| { | |
| "url":"^http://www\\.e-mansion\\.co\\.jp/bbs/board/", | |
| "pageElement":"//div[div/@class='list_item title']", | |
| "nextLink":"//a[@class='next_bt sprite-next_bt']", | |
| "wedata.net.id":1948 | |
| }, | |
| { | |
| "url":"^https://support\\.office\\.com/[^/]+/search", | |
| "pageElement":"id('ocSearchResults')/div", | |
| "nextLink":"id('ocNextPage')/a", | |
| "wedata.net.id":79968 | |
| }, | |
| { | |
| "url":"^http://raido\\.sakura\\.ne\\.jp/southly/rn/", | |
| "pageElement":"//div[@class='main']/div[@class='page_link'][1]/following-sibling::*[following-sibling::div/@class='page_link']", | |
| "nextLink":"//div[@class='page_link']/a[contains,'>>')]", | |
| "wedata.net.id":63932 | |
| }, | |
| { | |
| "url":"^http://www5e\\.biglobe\\.ne\\.jp/~aji/3min/", | |
| "insertBefore":"//p[@class=\"menu_bottom\"]", | |
| "pageElement":"//div[@class=\"main\"]", | |
| "nextLink":"//p[@class=\"menu_bottom\"]/span[3]/a", | |
| "wedata.net.id":404 | |
| }, | |
| { | |
| "url":"^http://f\\.hatena\\.ne\\.jp/mobile/[-\\w]+/", | |
| "pageElement":"//div[contains(concat(\" \", @class, \" \"), \" fotolist \") or contains(concat(\" \", @class, \" \"), \" foto-body \")]", | |
| "nextLink":"//a[@directkey=\"6\"]", | |
| "wedata.net.id":55503 | |
| }, | |
| { | |
| "url":"^http://www\\.impress\\.co\\.jp/newsrelease/", | |
| "pageElement":"//div[@class=\"listbox\"]", | |
| "nextLink":"//li[@class=concat(\"y\",number(substring-before(substring-after(//link[@rel=\"canonical\"]/@href,\"http://www.impress.co.jp/newsrelease/\"),\"/\")))]/following-sibling::li[1]/a|//ul[@class=\"yearlist\"][//link[@rel=\"canonical\"]/@href=//link[@rel=\"start\"]/@href]/li[2]/a", | |
| "wedata.net.id":2629 | |
| }, | |
| { | |
| "url":"^http://mao\\.s151\\.xrea\\.com/tumbrowser/", | |
| "pageElement":"//*[contains(concat(\" \", normalize-space(@class), \" \"), \" hentry \")]'", | |
| "nextLink":"//a[contains(concat(\" \", translate(normalize-space(@rel), \"ENTX\", \"entx\"), \" \"), \" next \")]", | |
| "wedata.net.id":74867 | |
| }, | |
| { | |
| "url":"^http://(info|blog)\\.setona\\.bitter\\.jp/", | |
| "pageElement":"//table[@class='waku1']|//div[@class='entry'][not(//table/@class='waku1')]", | |
| "nextLink":"//div[@class='page_navi']/a[contains(.),'>>')]", | |
| "wedata.net.id":63328 | |
| }, | |
| { | |
| "url":"^http://book(\\.akahoshitakuya|meter)\\.com", | |
| "pageElement":"id('status_box')/div[contains(@class, 'book_list_simple_box')]|//div[@class='log_list_box' or contains(concat(@class, ' '),'_list_box \") or @class='user_list']|id('main_right')/div[@class='inner\"]/div[@class='inner']/div[@class='log_list_box' or @class='tr_bgs2']|id('main_right main_left')//div[contains(concat(' ',@class,' '),' book ')]", | |
| "nextLink":"//span[@class='now_page']/following-sibling::span/a|//center/a[contains(., '→next')]|//a[.='次へ→']", | |
| "wedata.net.id":1960 | |
| }, | |
| { | |
| "url":"^http://www\\.lisani\\.jp/interview-report/", | |
| "pageElement":"//div[@class=\"userInputArea\"]", | |
| "nextLink":"//li[@class=\"btnNext\"]/a", | |
| "wedata.net.id":79961 | |
| }, | |
| { | |
| "url":"^http://self-reference\\.engine\\.sub\\.jp/", | |
| "pageElement":"//div[@id='entry']", | |
| "nextLink":"//div[@class='entry_navi'][count(./a)>1 or ./a[@href='http://self-reference.engine.sub.jp/?page=1']]/a[last()]", | |
| "wedata.net.id":79958 | |
| }, | |
| { | |
| "url":"^http://esupa\\.xrea\\.jp/nicky/nicky\\.cgi", | |
| "pageElement":"//div[@class='autopagerize_page_element']/*[@class='honbun' or self::h2]", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":1996 | |
| }, | |
| { | |
| "url":"^https?://www\\.tokyo-(?:porn-)?tube\\.com/", | |
| "pageElement":"//div[@class=\"postBox\"][./a]", | |
| "nextLink":"//ul[@class=\"pager\"]//li[./a[@class=\"on\"]]/following-sibling::li[1]/a", | |
| "wedata.net.id":54450 | |
| }, | |
| { | |
| "url":"^http://www\\.rantlifestyle\\.com/category/", | |
| "pageElement":"//article", | |
| "nextLink":"//a[contains(.,'Older Posts')]", | |
| "wedata.net.id":74927 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?suruga-ya\\.jp/database/", | |
| "pageElement":"//table[@class=\"table1\"]", | |
| "nextLink":"//a[contains(text(), \">>\")]", | |
| "wedata.net.id":2021 | |
| }, | |
| { | |
| "url":"^http://up\\d?\\.karinto\\.in/uploader\\d?/", | |
| "pageElement":"//table[@class='file']//tr[td]", | |
| "nextLink":"id('rightbox')/div[@class='page_info']//em/following-sibling::*[1][self::a]", | |
| "wedata.net.id":63112 | |
| }, | |
| { | |
| "url":"http://bt\\.aisex\\.com/bt/thread\\.php\\?.", | |
| "insertBefore":"//table[5]", | |
| "pageElement":"//table[4]", | |
| "nextLink":"//table[last()]/tbody/tr/td/b/following-sibling::a", | |
| "wedata.net.id":1817 | |
| }, | |
| { | |
| "url":"^http://(www\\.)?nolleys(-mall|\\.co)\\.jp/", | |
| "pageElement":"//ul[@class='listSetting row-fluid liquid-column3']/li|//section[@class='entry'] | //table[@width='99%']//tr[td]", | |
| "nextLink":"//li[@class='pager_next']/a|//a[contains(.,'NEXT') or @class='link_next'] | //div[@class='naviprev']/article/a", | |
| "wedata.net.id":64145 | |
| }, | |
| { | |
| "url":"^http://www\\.newsfire(?:rss|x)\\.com/blog/", | |
| "pageElement":"id('content')/*[starts-with(self::div/@class,'post') or self::h2]", | |
| "nextLink":"//li[@class='icon prev']/a", | |
| "wedata.net.id":517 | |
| }, | |
| { | |
| "url":"^http://dailynewsonline\\.jp/article/\\d+/$", | |
| "pageElement":"//div[@class=\"textarea\"]/a[@class=\"nextpageControl\"]/preceding-sibling::*|//div[@class=\"textarea\"][not(./a[@class=\"nextpageControl\"])]", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":77720 | |
| }, | |
| { | |
| "url":"^http://www\\.iza\\.ne\\.jp/kiji/\\w+/news/", | |
| "pageElement":"//div[@class=\"text\"]/p", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":74822 | |
| }, | |
| { | |
| "url":"^http://www\\.meisterhero\\.com/blog/fiona/", | |
| "pageElement":"//div[@class='next']/preceding-sibling::*", | |
| "nextLink":"//a[.='次の月']", | |
| "wedata.net.id":39625 | |
| }, | |
| { | |
| "url":"http://movies.netflix.com/MoviesYouveSeen.+", | |
| "insertBefore":"//table[@class=\"agMovieSet agMovieTable\"][last()]", | |
| "pageElement":"//table[@class=\"agMovieSet agMovieTable\"]", | |
| "nextLink":"//a[@class=\"svf-button svfb-default next\"]", | |
| "wedata.net.id":72682 | |
| }, | |
| { | |
| "url":"^https://my\\.bookmark\\.rakuten\\.co\\.jp/", | |
| "pageElement":"//div[@class='main-item-section']", | |
| "nextLink":"//span[@class='revThisPage']/following-sibling::a", | |
| "wedata.net.id":77691 | |
| }, | |
| { | |
| "url":"^http://(?:[^./]+\\.)+typepad\\.(?:com|jp)/", | |
| "pageElement":"id(\"alpha-inner\")/*[(self::h2 and contains(concat(\" \", @class, \" \"), \" date-header \")) or (self::div and contains(concat(\" \", @class, \" \"), \" entry \"))]", | |
| "nextLink":"id(\"alpha-inner\")/div[contains(concat(\" \", @class, \" \"), \" pager \")]/div[@class=\"pager-inner\"]/span[@class=\"pager-right\"]/a", | |
| "wedata.net.id":2686 | |
| }, | |
| { | |
| "url":"^https?://job\\.rikunabi\\.com/2014/search/", | |
| "pageElement":"//ul[@class='search-cassetteList']/li", | |
| "nextLink":"//a[@rel='prev']", | |
| "wedata.net.id":63702 | |
| }, | |
| { | |
| "url":"^http://blog\\.goo\\.ne\\.jp/thetrailstore/", | |
| "pageElement":"//td[@class='entry']/div/table", | |
| "nextLink":"//td[@class='etNextPrev']/a", | |
| "wedata.net.id":2787 | |
| }, | |
| { | |
| "url":"^http://www\\.plus-blog\\.sportsnavi\\.com/", | |
| "pageElement":"id(\"articleBody\")", | |
| "nextLink":"//li[@class=\"page-next\"]/a", | |
| "wedata.net.id":77599 | |
| }, | |
| { | |
| "url":"^http://kurikuria\\.web\\.fc2\\.com/\\d+wa/", | |
| "pageElement":"//*[self::p or self::form]", | |
| "nextLink":"//a[starts-with(text(), \"\u6b21\")]", | |
| "wedata.net.id":39786 | |
| }, | |
| { | |
| "url":"^http://www\\.photogen\\.com/free\\-photos/", | |
| "pageElement":"//div[@class='imagebox']", | |
| "nextLink":"//a[@class='next page-numbers']", | |
| "wedata.net.id":26382 | |
| }, | |
| { | |
| "url":"^http://yamagata\\.int21h\\.jp/tool/Markov/", | |
| "pageElement":"//p", | |
| "nextLink":"//a[@accesskey=\"#\"]", | |
| "wedata.net.id":26580 | |
| }, | |
| { | |
| "url":"^http://croissantclub\\.magazineworld\\.jp/", | |
| "pageElement":"//ul[@class=\"thumb-grid clearfix\"]/li[not(//a[@rel])]|//div[@class=\"mt10 clearfix\"]/preceding-sibling::*", | |
| "nextLink":"//div[@class=\"nav-next\"]/a[not(@rel)]|//a[@rel=\"next\"]", | |
| "wedata.net.id":77478 | |
| }, | |
| { | |
| "url":"^http://toriyamazine\\.blog100\\.fc2\\.com/", | |
| "pageElement":"id(\"main\")/div[contains(concat(\" \", @class, \" \"), \" section \")]", | |
| "nextLink":"id(\"main\")/ul[@class=\"navi\"]/li[@class=\"next\"]/a", | |
| "wedata.net.id":34811 | |
| }, | |
| { | |
| "url":"^http://.+\\.nhk\\.or\\.jp/.*search.*\\.cgi", | |
| "pageElement":"id('search-contents')/article/section|//div[@class='resultData']//tr|//ul[@class='search--list']/li", | |
| "nextLink":"//p[@class='search-more-results']/a|id('pi_but_next')/a|//a[@class='next']", | |
| "wedata.net.id":75026 | |
| }, | |
| { | |
| "url":"^http://shadingskin\\.web\\.fc2\\.com/slow/", | |
| "pageElement":"//table", | |
| "nextLink":"//a[text()=\"Next\uff1e\"]", | |
| "wedata.net.id":33723 | |
| }, | |
| { | |
| "url":"^http://nga\\.178\\.com/(read|thread)\\.php", | |
| "pageElement":"id('topicrows m_posts_c')/*[self::tbody or @class='forumbox postbox']", | |
| "nextLink":"//div[@class='left']//td[a/@class=' invert']/following-sibling::td/a", | |
| "wedata.net.id":73789 | |
| }, | |
| { | |
| "url":"^https?://(www\\.)?webcam-archiver\\.com/.+", | |
| "pageElement":"//div[@class=\"main-section\"][1]/div[@class=\"container-fluid\"][1]/div[@class][1]", | |
| "nextLink":"//ul[@class=\"pagination\"]/li[@class=\"active\"]/following-sibling::li[1]/a[1]", | |
| "wedata.net.id":77462 | |
| }, | |
| { | |
| "url":"^http://emedicine\\.medscape\\.com/article/", | |
| "pageElement":"//div[@class='back_next_btn']/preceding-sibling::*", | |
| "nextLink":"//div[@class='next_btn']/a", | |
| "wedata.net.id":33056 | |
| }, | |
| { | |
| "url":"^http://www\\.pixiv\\.net/ranking_log\\.php", | |
| "pageElement":"//table[contains(concat(\" \", @class, \" \"), \" calender_ranking \")]/..", | |
| "nextLink":"//div[contains(concat(\" \", @class, \" \"), \" calendar-selector \")]//li[a[contains(concat(\" \", @class, \" \"), \" active \")]]/preceding::li[position()=1 and ancestor::div[contains(concat(\" \", @class, \" \"), \" calendar-selector \")]]/a", | |
| "wedata.net.id":26720 | |
| }, | |
| { | |
| "url":"^http://www\\.starnewsonline\\.com/article/", | |
| "pageElement":"//div[@class='pagholder']", | |
| "nextLink":"//a[text()='Next Page']", | |
| "wedata.net.id":60619 | |
| }, | |
| { | |
| "url":"^http://idolmaster\\.jp/other/product\\.php", | |
| "pageElement":"id(\"product\")/div[contains(concat(\" \",@class,\" \"),\" detailCol \")]", | |
| "nextLink":"//div[@class=\"paging\"]/span/following-sibling::a", | |
| "wedata.net.id":77433 | |
| }, | |
| { | |
| "url":"^http://news4vip\\.livedoor\\.biz/archives/", | |
| "pageElement":"//div[@class=\"article-body-more\"]//a[@onclick]/following-sibling::*[self::div or self::br][not(@id)]|//div[@class=\"thread\"]/following-sibling::*[self::div or self::br]|//div[@class=\"article-body-more\"][//div[@class=\"thread\"]]//a[@onclick]/following-sibling::*[self::div[@id] or self::br][following-sibling::div[last()]]|//span[@style=\"color: rgb(255, 0, 0);\"][//div[@class=\"thread\"]]/preceding-sibling::*[self::div or self::br]|//div[@class=\"article-body-more\"][not(./div[@class=\"t_h\"])]/div[contains(@class,\"t_h\")][1]/following-sibling::*[self::div or self::br]|//div[@class=\"article-body-more\"]/div[@id=\"resid%no%\"]/div[@class=\"t_h\"]|id(\"ently_text\")|//h2[@class=\"ently_title\"]|//div[@class=\"ently_navi_top\"]|//a[@name=\"comments\"]/following-sibling::*|//div[@class=\"commentForm\"]", | |
| "nextLink":"//div[@class=\"menu\"]/a[1]", | |
| "wedata.net.id":77372 | |
| }, | |
| { | |
| "url":"^http://k\\.hatena\\.ne\\.jp/[^/]+/modified", | |
| "pageElement":"//div[@class='keyword-list-blog']", | |
| "nextLink":"//div[@class='pager']/a[contains(.,'過去')]", | |
| "wedata.net.id":65562 | |
| }, | |
| { | |
| "url":"^http://www\\.passiveaggressivenotes\\.com/", | |
| "pageElement":"id(\"content\")/*[self::h2 or self::h4 or self::div[contains(concat(\" \", @class, \" \"), \" entry \")]]", | |
| "nextLink":"//a[contains(concat(\" \", @class, \" \"), \" next \")]", | |
| "wedata.net.id":55829 | |
| }, | |
| { | |
| "url":"^http://www\\.aozora\\.gr\\.jp/index_pages/", | |
| "pageElement":"//table[@class='list']/tbody/tr[1]/following-sibling::tr", | |
| "nextLink":"//a[contains(.,'次の50件')]", | |
| "wedata.net.id":27279 | |
| }, | |
| { | |
| "url":"^http://yahooauctionwatch\\.livedoor\\.biz/", | |
| "pageElement":"id(\"blog\")/div[contains(concat(\" \",@class,\" \"), \" pager \")]/preceding-sibling::*", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":55120 | |
| }, | |
| { | |
| "url":"^http://mangalifewin\\.takeshobo\\.co\\.jp/", | |
| "pageElement":"//div[@class=\"extMdlSeriesMngrArticleMargin\"]/a|//div[@class=\"extMdlSeriesMngrArticleMargin\"]/div[1][.//h3[@class=\"articleTitle\"][number(substring-before(substring-after(./text(),\"-\"),\"]\"))=1]]|//ul[@class=\"nav\"]/preceding-sibling::img", | |
| "nextLink":"//li[@class=\"next\"]/a|//a[@title=\"next page\"]", | |
| "wedata.net.id":60005 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?moug\\.net/(?:faq|tech)/", | |
| "pageElement":"id('zebra')//tr[td]", | |
| "nextLink":"id(\"center\")//b/following-sibling::a[1]", | |
| "wedata.net.id":27429 | |
| }, | |
| { | |
| "url":"^http://(penthouse|adultfriendfinder).com.+", | |
| "pageElement":"//*[@id=\"GalleryImg\"]/parent::div", | |
| "nextLink":"//*[@id=\"pagination\"]/ul/li[last()]/a[last()]", | |
| "wedata.net.id":77263 | |
| }, | |
| { | |
| "url":"^http://www\\.cinema\\.de/kino/kinoprogramm", | |
| "pageElement":"//div[div/@class='details clearfix']/*", | |
| "nextLink":"//a[@class='btn-left']", | |
| "wedata.net.id":77245 | |
| }, | |
| { | |
| "url":"^http://hide\\.maruo\\.co\\.jp/lib/hilight/", | |
| "pageElement":"//a[.='『戻る』']/preceding-sibling::*[preceding::form][position() > 1][position() < last()-2]", | |
| "nextLink":"//a[.='『戻る』']/preceding-sibling::table[position()=1]//td[b]/following-sibling::td[position()=1]/a", | |
| "wedata.net.id":28945 | |
| }, | |
| { | |
| "url":"^https://www\\.bookscan\\.co\\.jp/interview", | |
| "pageElement":"//article/*", | |
| "nextLink":"//a[@class='all active']", | |
| "wedata.net.id":73994 | |
| }, | |
| { | |
| "url":"^https?://github\\.com/[^/]+/[^/]+/watchers", | |
| "pageElement":"//ol[@class='follow-list clearfix']/li", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":1220 | |
| }, | |
| { | |
| "url":"^http://www\\.s2comix\\.com/mag_backn\\.php", | |
| "pageElement":"id(\"content\")", | |
| "nextLink":"id(\"content\")/div[@class=\"pagedLink\"]/span[@class=\"current\"]/following-sibling::a", | |
| "wedata.net.id":67081 | |
| }, | |
| { | |
| "url":"^http://sai-zen-sen\\.jp/(?:works|special)/", | |
| "pageElement":"id(\"book-body\")/*[contains(concat(\" \",@class,\" \"),\" book-page-spread \")]", | |
| "nextLink":"id(\"volumes_next\")/a", | |
| "wedata.net.id":55384 | |
| }, | |
| { | |
| "url":"^http://.+\\.watch\\.impress\\.co\\.jp/img/", | |
| "pageElement":"//table[contains(@class,\"image_table\")]//tr[not(@class=\"paging_row\")]| id(\"main-image-wrap\")", | |
| "nextLink":"//li[@class=\"next\"]//a", | |
| "wedata.net.id":48128 | |
| }, | |
| { | |
| "url":"^https?://(hon|shop)\\.gakken(\\.co)?\\.jp/", | |
| "pageElement":"id('list')/ul/li|//tbody[tr/td[@valign='top'][@width='98']]/*", | |
| "nextLink":"//a[contains(.,'次へ') or contains(.,'次のページ')]", | |
| "wedata.net.id":63198 | |
| }, | |
| { | |
| "url":"^http://house\\.goo\\.ne\\.jp/(?:buy|rent)/", | |
| "pageElement":"//tr[@class='bukkennhover']", | |
| "nextLink":"//a[.='次へ→']", | |
| "wedata.net.id":29490 | |
| }, | |
| { | |
| "url":"^https?://([^.]+\\.)?answers\\.yahoo\\.com/", | |
| "pageElement":"id('ya-qn-answers')/li", | |
| "nextLink":"//a[@aria-pressed='true']/following-sibling::a[1]", | |
| "wedata.net.id":32691 | |
| }, | |
| { | |
| "url":"^https?://www\\.psychologytoday\\.com/blog/", | |
| "pageElement":"//div[./div[@data-type=\"blog_entry\"]]", | |
| "nextLink":"//li[@class=\"pager-next\"]/a", | |
| "wedata.net.id":46303 | |
| }, | |
| { | |
| "url":"^http://news\\.livedoor\\.com/[^/]+/topics/", | |
| "pageElement":"//div[@class='keywordBody']/*", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":30467 | |
| }, | |
| { | |
| "url":"^http://community\\.us\\.playstation\\.com/", | |
| "pageElement":"id('messageList')//tr[td]|//div[starts-with(@id,'lineardisplaymessageviewwrapper')]", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":32561 | |
| }, | |
| { | |
| "url":"^http://(?:(blog\\.)?jogger|techblog)\\.pl/", | |
| "pageElement":"//div[@class='entry']|//table[@class='listing']/tbody/tr", | |
| "nextLink":"//div[@class=\"pager\"]/ul/li[@class=\"active\"]/following-sibling::li[1]/a|//link[@rel=\"prev\"]", | |
| "wedata.net.id":32550 | |
| }, | |
| { | |
| "url":"^http://kazeyomite(?:y\\.com|i\\.sblo\\.jp)", | |
| "pageElement":"//div[@class='blog']", | |
| "nextLink":"id('content')/div[@class='navi']/text()[(number(normalize-space(self::text())) > 0) or (contains(self::text(),'1') and contains(self::text(),'-'))]/following-sibling::a[1]", | |
| "wedata.net.id":46145 | |
| }, | |
| { | |
| "url":"^http://(.+?\\.|joy|porn)reactor\\.(cc|com)", | |
| "pageElement":"id('post_list')/div[@class='postContainer']", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":76967 | |
| }, | |
| { | |
| "url":"^http://www\\.muji\\.net/store/cmdty/search", | |
| "pageElement":"//div[@class='itemList']/ul/li", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":30916 | |
| }, | |
| { | |
| "url":"^http://portableapps\\.com/(?:forums|node)/", | |
| "pageElement":"id('forum-topic-list')/table//tr[td]|id('forum-comments')/*[not(@class='item-list')]", | |
| "nextLink":"//li[@class='pager-next']/a", | |
| "wedata.net.id":32477 | |
| }, | |
| { | |
| "url":"^http://www\\.gushnet\\.jp/(?:search|gush)/", | |
| "pageElement":"//div[@class=\"contents\"]", | |
| "nextLink":"//p[@class=\"next\"]/a | //div[@class=\"backnumber\"]/ul/li[a[text() = translate(//h2/text(), \"GUSH\", \"\")]]/following-sibling::li[1]/a[not(text()=\"バックナンバー\")]", | |
| "wedata.net.id":63641 | |
| }, | |
| { | |
| "url":"^https?://(www\\.)?thepiratebay\\.\\w{2,3}/", | |
| "pageElement":"id('searchResult')/tbody/tr[not(td/@style)]", | |
| "nextLink":"//a[contains(img/@src,'next')]", | |
| "wedata.net.id":30946 | |
| }, | |
| { | |
| "url":"^https?://gree\\.jp/[^/]+/blog/entry/[0-9]+", | |
| "pageElement":"//td[@class=\"maincol\"]/div[contains(concat(\" \",normalize-space(@class),\" \"),\" box \")]", | |
| "nextLink":"//li[@class=\"prev\"]/a", | |
| "wedata.net.id":43411 | |
| }, | |
| { | |
| "url":"^http://www\\.mapee\\.jp/python/\\w+\\.html", | |
| "pageElement":"id(\"con_main\")/*", | |
| "nextLink":"//div[contains(concat(\" \", @class, \" \"), \" next_p \")]/a", | |
| "wedata.net.id":42152 | |
| }, | |
| { | |
| "url":"^http://search\\.(?:profile\\.)?ameba\\.jp/", | |
| "pageElement":"//ul[@class=\"seachResult\"]/li", | |
| "nextLink":"id(\"blogEntry\")//div[@class=\"more\"]/a|//a[@class=\"fwd\"]", | |
| "wedata.net.id":31722 | |
| }, | |
| { | |
| "url":"^http://bupo\\.jp/ishikei/cgroom6b/\\w+.htm", | |
| "pageElement":"//a[contains(@href,\"cgroom6.htm\")]/following-sibling::node()", | |
| "nextLink":"(//p/a/following-sibling::text()|//p/a/preceding-sibling::text())[number(translate(normalize-space(.),\"\uff11\uff12\uff13\uff14\uff15\uff16\uff17\uff18\uff19\",\"123456789\"))>0]/following-sibling::a", | |
| "wedata.net.id":55273 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?dommune\\.com/ele-king/.", | |
| "pageElement":"//div[@class='EntryNavi']/preceding-sibling::*[not(@class='FR DiskTableMiki')]", | |
| "nextLink":"//span[@class='EntryNaviOn'][count(a)=0]/following-sibling::node()/a", | |
| "wedata.net.id":32041 | |
| }, | |
| { | |
| "url":"^http://www\\.poco2\\.jp/special/interview/", | |
| "pageElement":"id('mainBlk')/*[not(@class='pageMov'\")]", | |
| "nextLink":"id('pageLink')//li[@class='btnNext']/a", | |
| "wedata.net.id":76701 | |
| }, | |
| { | |
| "url":"^http://www\\.imdb\\.com/movies-coming-soon", | |
| "pageElement":"//div[@class='list detail']", | |
| "nextLink":"//a[.='Next']", | |
| "wedata.net.id":74673 | |
| }, | |
| { | |
| "url":"https://japan\\.techrepublic\\.com/article/", | |
| "pageElement":"id(\"content\")//article/div", | |
| "nextLink":"id(\"content\")//nav/a[contains(concat(\" \",@class,\" \"),\" next \")]", | |
| "wedata.net.id":80949 | |
| }, | |
| { | |
| "url":"^http://www\\.bookoffonline\\.co\\.jp/disp/", | |
| "pageElement":"id(\\\"mypageWrapper\\\")", | |
| "nextLink":"//div[@class=\\\"numNavi\\\"]//a[contains(text(),\\\">>\\\")]", | |
| "wedata.net.id":32096 | |
| }, | |
| { | |
| "url":"^http://dim2database\\.blog38\\.fc2\\.com/", | |
| "pageElement":"//div[@id=\"galleryset\"]", | |
| "nextLink":"//link[@rel=\"next\"]", | |
| "wedata.net.id":76879 | |
| }, | |
| { | |
| "url":"^http://[^.]+\\.hifi-forum\\.de/viewthread", | |
| "pageElement":"//table[@class='tbl table-even-odd']//tr[td]|//table[@class='tbl']/tbody/tr[th][last()]/following-sibling::tr[td/@class]", | |
| "nextLink":"//div[@class='pager']/b[last()]/following-sibling::a[1]", | |
| "wedata.net.id":38444 | |
| }, | |
| { | |
| "url":"^http://blog\\.hatena\\.ne\\.jp/-/feedback", | |
| "pageElement":"id('content')/article", | |
| "nextLink":"//div[@class=\"pager\"]/a", | |
| "wedata.net.id":56021 | |
| }, | |
| { | |
| "url":"^http?s://fakiki\\.com/products/list\\.php", | |
| "pageElement":"id(\"undercolumn\")/form[contains(@name,\"product_form\")]", | |
| "nextLink":"id(\"page_navi_top\")/div[contains(@class,\"pagenumber_area\")]/div[@class=\"navi\"]/a[contains(text(),\"次\")]", | |
| "wedata.net.id":76700 | |
| }, | |
| { | |
| "url":"^http://search\\.time\\.com/results\\.html", | |
| "pageElement":"//div[@class=\"tout\"]", | |
| "nextLink":"//a[@title=\"Next\"]", | |
| "wedata.net.id":32140 | |
| }, | |
| { | |
| "url":"http://www.jadore-jun.jp/products/list.php", | |
| "pageElement":"//ul[contains(@class,\"productList\")]", | |
| "nextLink":"//ul[contains(@class,\"productList\")]/following-sibling::div[contains(@class,\"pageNation01\")][1]/ul[contains(@class,\"ul_pageNation01\")]/li[contains(@class,\"btn_pnNext01\")]/a", | |
| "wedata.net.id":76659 | |
| }, | |
| { | |
| "url":"^http://www\\.realworld\\.jp/crowd/history", | |
| "pageElement":"//table[@class=\"history list\"]/tbody", | |
| "nextLink":"//li[@class=\"next\"]/a", | |
| "wedata.net.id":65331 | |
| }, | |
| { | |
| "url":"^http://www\\.hubmed\\.org/search\\.cgi\\?", | |
| "pageElement":"//table[@class='results_table']//tr", | |
| "nextLink":"//a[@accesskey='n']", | |
| "wedata.net.id":32015 | |
| }, | |
| { | |
| "url":"^http://www\\.barks\\.jp/(?:feature|news)/", | |
| "pageElement":"//section[@class=\"news_body\"]", | |
| "nextLink":"//a[@class=\"nextprev next\"]", | |
| "wedata.net.id":32012 | |
| }, | |
| { | |
| "url":"^http://www\\.ctrans\\.org/search\\.php\\?", | |
| "pageElement":"id('page-index')/preceding-sibling::*", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":32166 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?idee-online\\.com/shop/", | |
| "pageElement":"//div[@class='clearfix itemList']/ul", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":31935 | |
| }, | |
| { | |
| "url":"^http://togetter\\.com/(?!li/\\d|tagcloud)", | |
| "pageElement":"//ul[@class='simple_list']/li", | |
| "nextLink":"//link[@rel=\"next\"]", | |
| "wedata.net.id":31776 | |
| }, | |
| { | |
| "url":"^http://www\\.google\\.co\\.jp/products\\?", | |
| "pageElement":"id(\"results\")", | |
| "nextLink":"id(\"nn\")/parent::a", | |
| "wedata.net.id":38952 | |
| }, | |
| { | |
| "url":"^http://ayacy\\.inasoft\\.org/kamionovels/", | |
| "pageElement":"id('main')", | |
| "nextLink":"//link[@rel='next']", | |
| "wedata.net.id":63871 | |
| }, | |
| { | |
| "url":"^http://blog\\.seesaa\\.jp/contents/genre/", | |
| "pageElement":"//div[@class='pb10 clearfix']/*", | |
| "nextLink":"//span[@class='now-page-num']/following-sibling::span[1]/a", | |
| "wedata.net.id":55436 | |
| }, | |
| { | |
| "url":"^http://blog\\.hatena\\.ne\\.jp/\\-/recent", | |
| "pageElement":"id(\"item-list\")/ul", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":74890 | |
| }, | |
| { | |
| "url":"^http://specialnotes\\.blog77\\.fc2\\.com/", | |
| "pageElement":"id(\"Contents\")/div[@class=\"Entry\" or @id=\"Comment-View\" or @id=\"Comment-Form\" or @id=\"Trackback-View\"]", | |
| "nextLink":"//a[@title=\"前の記事\" or @title=\"次のページ\"]", | |
| "wedata.net.id":1855 | |
| }, | |
| { | |
| "url":"^http://[^.]+\\.trek(?:lens|nature)\\.com/", | |
| "pageElement":"id('content')//*[td/a or @class='row clearfix critiques']", | |
| "nextLink":"id('pages')/strong/following-sibling::a[1]", | |
| "wedata.net.id":551 | |
| }, | |
| { | |
| "url":"^http://www\\.(1galaxy)?s4wallpaper\\.com/", | |
| "pageElement":"id(\"main\")/div[contains(@class,\"entry\")]|id(\"main\")/div[@class=\"content the_gallery\"]/div[@class=\"entry\"]", | |
| "nextLink":"id(\"pagination\")/span[@class=\"current\"]/following-sibling::a[1]|//div[@class=\"paging\"]//li[last()]/a[last()]", | |
| "wedata.net.id":76682 | |
| }, | |
| { | |
| "url":"^http://netamichelin\\.blog68\\.fc2\\.com/", | |
| "pageElement":"id('main_body')//*[self::h3 or @class='article']", | |
| "nextLink":"//center/a[@title='ねたミシュラン']/following-sibling::a[1]", | |
| "wedata.net.id":698 | |
| }, | |
| { | |
| "url":"^http://www\\.amazon\\.co\\.jp/gp/history/", | |
| "pageElement":"//form[@action=\"/gp/history\"]/table", | |
| "nextLink":"//td[@class=\"paginationNext\"]/a", | |
| "wedata.net.id":56663 | |
| }, | |
| { | |
| "url":"^http://store\\.lammfromm\\.jp/index\\.php", | |
| "pageElement":"id('productListing2')/ul[@class='nav']", | |
| "nextLink":"//a[contains(., '次へ')]", | |
| "wedata.net.id":65283 | |
| }, | |
| { | |
| "url":"^http://latlonglab\\.yahoo\\.co\\.jp/race/", | |
| "pageElement":"//div[contains(@class,'contents')]/table/tbody/tr[td/div/@class='racecase']", | |
| "nextLink":"//div[contains(@class, \"contents\")]/table/tbody/tr[1]/td/a[contains(.,'次')]", | |
| "wedata.net.id":31055 | |
| }, | |
| { | |
| "url":"^http://galaxyheavyblow\\.web\\.fc2\\.com/", | |
| "pageElement":"id(\"main\")/a/preceding-sibling::*|id(\"main\")[not(./a)]/br[last()]/preceding-sibling::*", | |
| "nextLink":"//div[@class=\"center\"][count(./a)>1]/a[1][not(@href=\"index.html\")]", | |
| "wedata.net.id":38237 | |
| }, | |
| { | |
| "url":"^http://www\\.bookoffonline\\.co\\.jp/disp", | |
| "pageElement":"id(\"resList\")/form/div[contains(@class,\"list_group\")]", | |
| "nextLink":"//a[contains(text(),\"\u6b21\u3078\")]", | |
| "wedata.net.id":2093 | |
| }, | |
| { | |
| "url":"^http://www\\.poplar\\.co\\.jp/saishinkan/", | |
| "pageElement":"id('page')/following-sibling::*[following-sibling::div/@id='page']", | |
| "nextLink":"//a[contains(.,'次の')]", | |
| "wedata.net.id":66643 | |
| }, | |
| { | |
| "url":"^https?://www\\.sharer\\.com\\.tw/article/", | |
| "pageElement":"id('divArticleList')//li", | |
| "nextLink":"id('lblpagebar')/div[1]/a[contains(.,'下一頁')]", | |
| "wedata.net.id":74629 | |
| }, | |
| { | |
| "url":"^http://www\\.toranoana\\.jp/shop/arrival/", | |
| "insertBefore":"//div[@id=\"footer\"]/preceding::div[position()=1]", | |
| "pageElement":"//div[@id=\"content\"]/table", | |
| "nextLink":"//div[@class=\"update_date\"]/../a[last()]", | |
| "wedata.net.id":31003 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?papy\\.co\\.jp/sc/list/", | |
| "pageElement":"id(\"main\")/div[not(*)]/following-sibling::div[following-sibling::div[not(*)]]", | |
| "nextLink":"id(\"main\")/div[contains(concat(\" \", @class, \" \"), \" listmenu \")]/div/div/a[.=\"\u6b21\u306e10\u4ef6\"]rn", | |
| "wedata.net.id":55240 | |
| }, | |
| { | |
| "url":"^http://(archive\\.)?as-web\\.jp/f1sokuho/", | |
| "pageElement":"//div[@class='news_relation_out'][.//h2]|id('common_list_all')/ul/li", | |
| "nextLink":"id('news_link_list')/div[not(span[@class='current']/following-sibling::span/@class='disabled')]/a[last()]|id('calendar_month_n')//li[@class=concat('b',number(substring-after(id('calendar_month_n')//li[contains(@class,'_on')]/a/@href,'m='))-1)]/a", | |
| "wedata.net.id":76478 | |
| }, | |
| { | |
| "url":"^http://www\\.chikumashobo\\.co\\.jp/blog/", | |
| "pageElement":"//div[@class=\"article\" or @class=\"entryarea\" or @class=\"entry\"] | id(\"entry\")", | |
| "nextLink":"//a[child::img[@alt=\"次のページへ\"]] | //*[@class=\"btn-next\"]/a", | |
| "wedata.net.id":64115 | |
| }, | |
| { | |
| "url":"^http://careerhack\\.en-japan\\.com/report", | |
| "pageElement":"id(\"contents-body\")/p[not(./a)]|id(\"contents-body\")/*[not(self::p or @id=\"report-tags\")]|//section/article", | |
| "nextLink":"id(\"contents-body\")/p[last()]/a|//a[@rel=\"next\"]", | |
| "wedata.net.id":63152 | |
| }, | |
| { | |
| "url":"^http://www\\.shinshokan\\.co\\.jp/search/", | |
| "pageElement":"id('f_list_src')/div/dl", | |
| "nextLink":"//a[contains(.,'次へ>>')]", | |
| "wedata.net.id":63189 | |
| }, | |
| { | |
| "url":"^http://www\\.adiumxtras\\.com/index\\.php", | |
| "pageElement":"id('content')//tr[.//img]", | |
| "nextLink":"id('content')/table[last()]//strong/following-sibling::a[1]", | |
| "wedata.net.id":412 | |
| }, | |
| { | |
| "url":"^http://www\\.readmanga\\.today/[^/]+/\\d+", | |
| "pageElement":"//div[contains(@class,'page_chapter') and img]", | |
| "nextLink":"//a[contains(@class,'next-a-btn')]", | |
| "wedata.net.id":80876 | |
| }, | |
| { | |
| "url":"^http://blog\\.asanoatsuko-on-koala\\.com/", | |
| "pageElement":"//div[@class=\"entry\"]", | |
| "nextLink":"//div[@class=\"page_navi\"]/a[contains(text(),\">>\")]", | |
| "wedata.net.id":74504 | |
| }, | |
| { | |
| "url":"^http://www\\.dosv\\.jp/back_number/[^/]+/", | |
| "pageElement":"//img[contains(@src, \"main_img02.jpg\")]/../../../../../../following-sibling::tr[following::img[contains(@src, \"try_next.gif\") or contains(@src, \"try_back.gif\")]]", | |
| "nextLink":"//img[contains(@src, \"try_next.gif\")]/../preceding-sibling::td/a[last()]", | |
| "wedata.net.id":1793 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?european-swingers\\.eu/", | |
| "pageElement":"id('plugs')//div[contains(concat(' ', @class, ' '), ' post ')]", | |
| "nextLink":"//ul[contains(concat(' ', @class, ' '), ' pagination ')]/li[contains(concat(' ', @class, ' '), ' cur_page ')]/following-sibling::li[1]/a", | |
| "wedata.net.id":57132 | |
| }, | |
| { | |
| "url":"^http://www\\.daiwashobo\\.co\\.jp/search/", | |
| "pageElement":"//div[@class=\"paging\"]/following-sibling::div[@class=\"contents\"]", | |
| "nextLink":"//div[@class=\"result\"]/a[contains(text(), \"次へ\")]", | |
| "wedata.net.id":63646 | |
| }, | |
| { | |
| "url":"^http://xoops\\.ec-cube\\.net/search\\.php", | |
| "pageElement":"//div[@id='content']/h5/following-sibling::*[following-sibling::table]", | |
| "nextLink":"id('content')//td[@align='right']/a[contains(.,'>>')]", | |
| "wedata.net.id":30687 | |
| }, | |
| { | |
| "url":"^http://d\\.hatena\\.ne\\.jp/[-\\w]+/touch", | |
| "pageElement":"//div[@class=\"body\"]/div[@class=\"pager\"]/preceding-sibling::*", | |
| "nextLink":"id(\"next-arrow\")/..", | |
| "wedata.net.id":55513 | |
| }, | |
| { | |
| "url":"^http://[^.]+\\.pokerstrategy\\.com/forum/", | |
| "pageElement":"//li[starts-with(@class,'forumthread')][last()]/ul/li", | |
| "nextLink":"//a[i/@class='icon noText icon-arrow-right']", | |
| "wedata.net.id":32569 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?dtptemple\\.org/imgbbs/", | |
| "pageElement":"id(\"thread tree table\")", | |
| "nextLink":"id(\"pager\")/ol/li[last()]/a", | |
| "wedata.net.id":30339 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?technologyreview\\.com/", | |
| "pageElement":"//section[@class='body']", | |
| "nextLink":"//a[@class='continue cta-block']", | |
| "wedata.net.id":2601 | |
| }, | |
| { | |
| "url":"^http://www2\\.ezbbs\\.net/09/shogidokoro/", | |
| "pageElement":"//form/center[1]", | |
| "nextLink":"//form/b/following-sibling::a[1]", | |
| "wedata.net.id":77681 | |
| }, | |
| { | |
| "url":"^http://(?:bl\\.|jp\\.)?ranobe-mori\\.net/", | |
| "pageElement":"//div[@class='blog']/*[@class='entry' or @class='date' or @class='list-header']", | |
| "nextLink":"//div[@class='content-nav']/a[not(position()=number())][1]|//link[@rel='prev'][not(//div[@class='content-nav'])]", | |
| "wedata.net.id":30287 | |
| }, | |
| { | |
| "url":"^http://d\\d?\\.hatena\\.ne\\.jp/diarylist", | |
| "pageElement":"//ul[@class=\"list-plain\"]", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":2649 | |
| }, | |
| { | |
| "url":"^http://search\\.metro\\.tokyo\\.jp/search", | |
| "pageElement":"//p[@class='g']", | |
| "nextLink":"//td[span/@class='i']/following-sibling::td[1]/a", | |
| "wedata.net.id":39756 | |
| }, | |
| { | |
| "url":"^https://(www|search)\\.literotica\\.com/.", | |
| "pageElement":"//div[contains(@class,'b-story-body-x') or @class='b-story-list']/div|//ul[contains(@class,'search_results')]/li", | |
| "nextLink":"//a[@class='b-pager-next']|//div[@class='page_nav']//li[last()-1]/a", | |
| "wedata.net.id":67057 | |
| }, | |
| { | |
| "url":"^http://profile\\.hatena\\.ne\\.jp/mobile/", | |
| "pageElement":"//div[@class=\"title\"]/following-sibling::div[1]/table", | |
| "nextLink":"//a[@class='pager-r pager-older']", | |
| "wedata.net.id":55517 | |
| }, | |
| { | |
| "url":"^http://www\\.xiami\\.com/group/thread/id/", | |
| "pageElement":"//table[@class='topic_list_idx']//tr[td]", | |
| "nextLink":"//a[@class='p_redirect_l']", | |
| "wedata.net.id":64385 | |
| }, | |
| { | |
| "url":"^http://[a-z]+\\.nationalgeographic\\.com/", | |
| "insertBefore":"//div[@class='splitnavR']", | |
| "pageElement":"//div[@class='story']/*[not(@class='inlinedate')]", | |
| "nextLink":"//a[.='Next Page >>']", | |
| "wedata.net.id":2828 | |
| }, | |
| { | |
| "url":"^http://www\\.newsarama\\.com/[^.]*archive", | |
| "pageElement":"//div[@class='archive_cont']/*", | |
| "nextLink":"//div[@class='archive_button archive_last']/a", | |
| "wedata.net.id":77067 | |
| }, | |
| { | |
| "url":"^http://www\\.performernotification\\.com/", | |
| "pageElement":"id(\"ctl00_ContentPlaceHolder1_PerformerList1_gvwPerformers\")//tr[position()>1 and position()<last()]", | |
| "nextLink":"//a[contains(concat(\" \", @class, \" \"), \" next \")]", | |
| "wedata.net.id":53515 | |
| }, | |
| { | |
| "url":"http://autoc-one\\.jp/drive-lady/.*\\.html", | |
| "pageElement":"//div[@class='special_large_image']", | |
| "nextLink":"//a[@class='half_right']", | |
| "wedata.net.id":77078 | |
| }, | |
| { | |
| "url":"^http://www\\.holytaco\\.com/(page/\\d+)?$", | |
| "pageElement":"//div[@class='post-item']", | |
| "nextLink":"//a[@class='nextpostslink']", | |
| "wedata.net.id":32704 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?zakzak\\.co\\.jp/[^/]+/", | |
| "pageElement":"id(\"main\")/div[@class=\"newsBox\"]/div[@class=\"textArea\"]|id(\"NewsDetail\")/div[@class=\"text\"]", | |
| "nextLink":"//a[contains(text(), \"続きを読む\")]|//a[contains(img/@src,\"next.gif\")]", | |
| "wedata.net.id":25636 | |
| }, | |
| { | |
| "url":"^http://springdawn\\.tumblr\\.com/(?!post)", | |
| "pageElement":"id(\"container\")", | |
| "nextLink":"id(\"next\")", | |
| "wedata.net.id":57987 | |
| }, | |
| { | |
| "url":"^http://ckworks\\.jp/comicdash/owner/user/", | |
| "pageElement":"id('main')/table/tbody/tr", | |
| "nextLink":"id('main')/div//a[.='>>']", | |
| "wedata.net.id":47947 | |
| }, | |
| { | |
| "url":"^http://textream\\.yahoo\\.co\\.jp/message", | |
| "pageElement":"//ul[@class='listStyleOpen']/li", | |
| "nextLink":"//a[.='次のページ']", | |
| "wedata.net.id":54846 | |
| }, | |
| { | |
| "url":"^http://www\\.melonbooks\\.com/index\\.php", | |
| "pageElement":"//ul[@class=\"itemlist\"]/li", | |
| "nextLink":"//ul[@class=\"pager\"]/li[contains(concat(\" \",@class,\" \"),\" now_location \")]/following-sibling::li/a", | |
| "wedata.net.id":76390 | |
| }, | |
| { | |
| "url":"^http://arstechnica\\.com/.*[?&]comments=1", | |
| "pageElement":"id('comments')/*", | |
| "nextLink":"//div[contains(@class,'next-page')]/a", | |
| "wedata.net.id":62047 | |
| }, | |
| { | |
| "url":"^http://www\\.pideo\\.net/(?:search|tweet)", | |
| "pageElement":"id(\"col1_content\")/ul[contains(concat(\" \",@class,\" \"),\" vids \")]", | |
| "nextLink":"id(\"col1_content\")//div[contains(concat(\" \",@class,\" \"),\" pages \")]/a[contains(text(),\"\u6b21\u3078\")]", | |
| "wedata.net.id":58697 | |
| }, | |
| { | |
| "url":"^http://www\\.(?:football|futsal)edge\\.jp", | |
| "pageElement":"//div[@class=\"body\"]/p[not(./a[not(./img)])]|//div[@class=\"body\"]/*[not(self::p)]", | |
| "nextLink":"id('postpage')/span/following-sibling::a[1]", | |
| "wedata.net.id":77188 | |
| }, | |
| { | |
| "url":"^http://blog\\.canpan\\.info/[^/]+/archive", | |
| "pageElement":"id(\"container\")//div[@class=\"entry\"]", | |
| "nextLink":"id(\"container\")/div[@class=\"page\"]/a", | |
| "wedata.net.id":25686 | |
| }, | |
| { | |
| "url":"^http://www5a\\.biglobe\\.ne\\.jp/~yo-he-/", | |
| "pageElement":"//p/*[self::br or self::img]", | |
| "nextLink":"//a[text()=\"\u6b21\u3078\"]", | |
| "wedata.net.id":25721 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?bb-nippon\\.com/column/", | |
| "pageElement":"//p[./span[contains(text(),\"目次\")]]/following-sibling::*|//p[contains(text(),\"目次\")]/following-sibling::*[not(@align=\"center\")]", | |
| "nextLink":"id(\"maincontents\")/div[@class=\"pagination\"]//li[last()]/a", | |
| "wedata.net.id":77534 | |
| }, | |
| { | |
| "url":"^http://www\\.tv-asahi\\.co\\.jp/.*search/", | |
| "pageElement":"id('searchResults')//li", | |
| "nextLink":"//p[@class='next']/a", | |
| "wedata.net.id":80699 | |
| }, | |
| { | |
| "url":"^http://ch\\.nicovideo\\.jp/(?:.*)/blomaga", | |
| "pageElement":"//article[@class='main']/div[@class='main_blog_txt']|id('comment_area')/*[starts-with(@class,'comment_') or self::form]|id('article_blog_title_area')//*[self::h1 or @class='article_blog_data']|//div[@class='article_end_data'][//article/@class='content black']|//div[@class='article_list_area calendar ']", | |
| "nextLink":"//li[@class='article_around before']/a|id('monthly_archive_record')/li[a[contains(.,concat(number(substring-before(substring-after(id('article_blog_title')/a/text(),'年'),'月')),'月'))]]/following-sibling::li[1]/a", | |
| "wedata.net.id":74806 | |
| }, | |
| { | |
| "url":"vozforums\\.com\\/search\\.php\\?searchid=", | |
| "pageElement":"id('inlinemodform')", | |
| "nextLink":"//div[@class='pagenav']//a[@rel='next']", | |
| "wedata.net.id":77200 | |
| }, | |
| { | |
| "url":"^http://www\\.kobunsha\\.com/shelf/search/", | |
| "pageElement":"//table[@class='magazine_bookImgTable']//tr", | |
| "nextLink":"//a[@class='n']", | |
| "wedata.net.id":63197 | |
| }, | |
| { | |
| "url":"^http://www\\.linkomanija\\.net/browse.php", | |
| "pageElement":"//table[2]/tbody", | |
| "nextLink":"//a[@class=\"pagelink\"][last()]", | |
| "wedata.net.id":76373 | |
| }, | |
| { | |
| "url":"^http://finance\\.toremaga\\.com/.+\\.html", | |
| "pageElement":"//div[@class='inspecial_text']/p/node()", | |
| "nextLink":"//div[@class='inspecial_nx_bf']//li[last()]/a", | |
| "wedata.net.id":29079 | |
| }, | |
| { | |
| "url":"^http://(?:[^./]+\\.)?photobucket\\.com/.+", | |
| "pageElement":"id('search-thumbnail-list')/div", | |
| "nextLink":"id('nextButton')", | |
| "wedata.net.id":667 | |
| }, | |
| { | |
| "url":"^http://www\\.nin-r\\.com/uneisha/netbaka/", | |
| "pageElement":"//p[@class='ac'][span/@class='img']/preceding-sibling::*", | |
| "nextLink":"//a[img/@alt='a.png']", | |
| "wedata.net.id":33055 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?rasysa\\.com/pkg/style/", | |
| "pageElement":"//div[@class='gallery-style-wrap ']", | |
| "nextLink":"//div[contains(@class,'pagination')]//li[@class='active']/following-sibling::li[1]/a", | |
| "wedata.net.id":28296 | |
| }, | |
| { | |
| "url":"^http://www\\.kyoto-np\\.co\\.jp/search\\?", | |
| "pageElement":"id('article')/div[.//*[starts-with(@class,'icon')]]", | |
| "nextLink":"//div[@style='text-align:center;']/a[contains(.,'次の')]", | |
| "wedata.net.id":26724 | |
| }, | |
| { | |
| "url":"^http://it\\.impressbm\\.co\\.jp/articles/", | |
| "pageElement":"id('article-editor')/*[not(@class='page-next font110')]", | |
| "nextLink":"//*[@rel='next']", | |
| "wedata.net.id":55392 | |
| }, | |
| { | |
| "url":"^http://www\\.news-postseven.com/archives/", | |
| "pageElement":"//div[@class='image'][ul/@class='clearfix sp']/a|//p[@class='text sp'][//div[@class='image']/ul/@class='clearfix sp']|//div[@class='detail clearfix']/*[not(@class='more' or @class='more sp')][not(//div/@class='image')]|//div[@class='main-news clearfix']/*[not(@class='social sp clearfix')][not(//div[@class='detail clearfix']/p/@class='more') or //div[@class='detail clearfix']/p[@class='more' or @class='more sp'][last()]/a[1][@class='next']]", | |
| "nextLink":"//a[(.|..)/@class='next']", | |
| "wedata.net.id":77256 | |
| }, | |
| { | |
| "url":"^http://www\\.akatsuki-novels\\.com/novels", | |
| "pageElement":"//div[@class='topicsBox']", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":80860 | |
| }, | |
| { | |
| "url":"^https?://(?:[^.]+\\.)?torrentleech\\.org/", | |
| "pageElement":"id(\"torrents\")", | |
| "nextLink":"//a[@class=\"pagnext\"]", | |
| "wedata.net.id":65584 | |
| }, | |
| { | |
| "url":"^http://yomou\\.syosetu\\.com/search\\.php", | |
| "pageElement":"//div[@class=\"searchkekka_box\"]", | |
| "nextLink":"//a[@class=\"nextlink\"]", | |
| "wedata.net.id":55132 | |
| }, | |
| { | |
| "url":"^http://graph\\.hatena\\.ne\\.jp/graphlist", | |
| "pageElement":"id(\"graphlist\")", | |
| "nextLink":"id(\"body\")//div[@class=\"pager\"]/a[contains(text(), \">\")]", | |
| "wedata.net.id":27759 | |
| }, | |
| { | |
| "url":"^http://www\\.ryukyujima\\.net/photo\\.php", | |
| "pageElement":"//div[@class=\"content\"]/*[self::table[starts-with(@summary, \"\u5199\u30e1\")] or self::hr]", | |
| "nextLink":"//a[@class=\"pager\" and ./preceding-sibling::b][1]", | |
| "wedata.net.id":27094 | |
| }, | |
| { | |
| "url":"^https?://.*\\.ebay(?:\\.[^./]{2,3}){1,2}/", | |
| "pageElement":"id('ListViewInner srchrslt-adtable')/li|//div[@class='row-fluid item-cell' or @class='span3 item-cell h-small']", | |
| "nextLink":"//a[starts-with(@class,'gspr next') or contains(@class,'paging-next')]", | |
| "wedata.net.id":59809 | |
| }, | |
| { | |
| "url":"^http://my_sarisari_store\\.typepad\\.com/", | |
| "pageElement":"id(\"beta-inner\")/div[starts-with(@id, \"entry-\")]", | |
| "nextLink":"id(\"beta-inner\")//span[@class=\"pager-right\"]/a", | |
| "wedata.net.id":27603 | |
| }, | |
| { | |
| "url":"^http://s-avatar\\.jp/scenario/reaction/.+", | |
| "pageElement":"//div[@class='scenario_text_6']/div[@style='text-align:center;']/following-sibling::node()[following-sibling::div[@style='text-align:center;']]", | |
| "nextLink":"//a[contains(.,'Next')]", | |
| "wedata.net.id":73885 | |
| }, | |
| { | |
| "url":"^https?://shop\\.bandainamcoent\\.co\\.jp/", | |
| "pageElement":"//div[@class='ItemList05']", | |
| "nextLink":"//p[@class='PageNav']/span[@class='current']/following-sibling::span/a", | |
| "wedata.net.id":77375 | |
| }, | |
| { | |
| "url":"^http://illust-bbs\\.webclap\\.com/type_a/", | |
| "pageElement":"id(\"footer\")/preceding-sibling::table", | |
| "nextLink":"//p/b/following-sibling::a[number(translate(.,\"[]\",\"\"))>0]", | |
| "wedata.net.id":55761 | |
| }, | |
| { | |
| "url":"^http://hypnopics-collective\\.net/cpg132/", | |
| "pageElement":"//table[@class=\"maintable\"]", | |
| "nextLink":"//td[@class=\"tableb_compact\"]/following-sibling::td/a", | |
| "wedata.net.id":32817 | |
| }, | |
| { | |
| "url":"^http://www\\.ogurahiroshi\\.net/category/", | |
| "pageElement":"//div[@class=\"post\"]", | |
| "nextLink":"//span[@class=\"nav-previous\"]/a", | |
| "wedata.net.id":77331 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?watts-jp\\.com/cathand/", | |
| "pageElement":"//table[@class=\"tbType_search\"]/tbody/tr", | |
| "nextLink":"//li[contains(@class,\"arrow\")]/a", | |
| "wedata.net.id":27266 | |
| }, | |
| { | |
| "url":"^http://lambda\\.bugyo\\.tk/cdr/mwl\\d{2}/", | |
| "pageElement":"//*[self::br or self::img]", | |
| "nextLink":"//a[contains(text(),\"Next>\")]", | |
| "wedata.net.id":32822 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?k-seven\\.co\\.jp/blog_", | |
| "pageElement":"//div[@class=\"bg3_h3\" or @class=\"blogtxt\"]", | |
| "nextLink":"//td[@align=\"right\"]/a[child::img[@alt=\"Next\"]]", | |
| "wedata.net.id":27386 | |
| }, | |
| { | |
| "url":"^http://www\\.century\\.co\\.jp/products/", | |
| "pageElement":"id(\"infoBox\")/dl", | |
| "nextLink":"//div[@class=\"pagePartitionTop\"]/b/following-sibling::a", | |
| "wedata.net.id":40457 | |
| }, | |
| { | |
| "url":"^http://www\\.sexyandfunny\\.com/featured", | |
| "pageElement":"//div[@class=\"Date\"]/parent::div[@class=\"content\"]", | |
| "nextLink":"//div[@id=\"paging\"]/a[@class=\"thispage\"]/following-sibling::a", | |
| "wedata.net.id":65544 | |
| }, | |
| { | |
| "url":"^https?://www\\.flickr\\.com/photos/tags/", | |
| "pageElement":"id('GoodStuff')/div[1]", | |
| "nextLink":"//a[@class='Next rapidnofollow']", | |
| "wedata.net.id":462 | |
| }, | |
| { | |
| "url":"^http://ch\\.nicovideo\\.jp/search/movie/", | |
| "pageElement":"id(\"result_search\")", | |
| "nextLink":"//div[@class=\"searchPage\"]/span[@class=\"here\"]/following-sibling::a", | |
| "wedata.net.id":63696 | |
| }, | |
| { | |
| "url":"^http://cgi\\.search\\.biglobe\\.ne\\.jp/", | |
| "pageElement":"id(\"searchResult\")/ol", | |
| "nextLink":"//li[contains(concat(\" \", @class, \" \"), \" nextPage \")]/a", | |
| "wedata.net.id":52647 | |
| }, | |
| { | |
| "url":"^http://www\\.gifwithsauce\\.com/noSource", | |
| "pageElement":"//ul[@class=\"thumbnails\"]/li", | |
| "nextLink":"//li[@class=\"next\"]/a", | |
| "wedata.net.id":73884 | |
| }, | |
| { | |
| "url":"^http://www\\.linuxjournal\\.com/content/", | |
| "pageElement":"//div[@class='node-inner']/div[@class='content']/*[not(@class='links')]", | |
| "nextLink":"//li[@class='pager-next']/a", | |
| "wedata.net.id":77275 | |
| }, | |
| { | |
| "url":"^http://www\\.pubridge\\.jp/i_love_ebook/", | |
| "pageElement":"id(\"kijiBox\")/ul[@id=\"ulNum\"]/preceding-sibling::*", | |
| "nextLink":"id(\"ulNum\")/li[./a[@class=\"current\"]]/following-sibling::li[1]/a", | |
| "wedata.net.id":77268 | |
| }, | |
| { | |
| "url":"^http://search\\.blogs\\.yahoo\\.co\\.jp/", | |
| "pageElement":"//ul[@class='articleSearchResult']/li", | |
| "nextLink":"//li[span/@class='current']/following-sibling::li[1]/a", | |
| "wedata.net.id":55400 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?spacefellowship\\.com/", | |
| "pageElement":"id('NewsPagination')/preceding-sibling::div[1]/preceding-sibling::*", | |
| "nextLink":"id(\"NewsPagination\")/span[@class=\"PageButtonsSelected\"]/following-sibling::span[1]/a", | |
| "wedata.net.id":28178 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?ebuyer\\.com/search\\?", | |
| "pageElement":"//div[starts-with(@class,'listing-product')]", | |
| "nextLink":"//li[@class='next-page']/a", | |
| "wedata.net.id":28385 | |
| }, | |
| { | |
| "url":"^http://sinkan\\.net/\\?action_users=true", | |
| "pageElement":"id('users_list')/table[@class='user']", | |
| "nextLink":"id('current')/following-sibling::span[1]/a", | |
| "wedata.net.id":32815 | |
| }, | |
| { | |
| "url":"^http://absolutelyfabulousgalleries\\.me/", | |
| "pageElement":"//div[@class='gallery_item_wrapper item_1']", | |
| "nextLink":"id('bottom_next_button')", | |
| "wedata.net.id":80871 | |
| }, | |
| { | |
| "url":"^https?://search\\.yahoo\\.co\\.jp/search", | |
| "pageElement":"id('WS2m')/*", | |
| "nextLink":"//a[contains(span[2],'>')]", | |
| "wedata.net.id":585 | |
| }, | |
| { | |
| "url":"^http://ekizo\\.mandarake\\.co\\.jp/shop/", | |
| "pageElement":"id(\"main\")/*[self::div[starts-with(@id, \"layout\")] or self::table]", | |
| "nextLink":"id(\"list\")//a[normalize-space()=\"次のページ\"]", | |
| "wedata.net.id":26594 | |
| }, | |
| { | |
| "url":"^http://weekly\\.ascii\\.jp/elem/000/000/", | |
| "pageElement":"//table[@class=\"img\"]//a[./img[contains(@title,\"karekare\") or contains(@src,\"karekare\") or contains(@src,\"iki_\")]]|id(\"articleHead\")", | |
| "nextLink":"//ul[@class=\"related\" or @class=\"list\"]//a[contains(text(),concat(\"第\",number(substring-before(substring-after(//h1[@itemprop=\"headline\"]/text(),\"第\"),\"回\"))+1,\"回\"))]", | |
| "wedata.net.id":61060 | |
| }, | |
| { | |
| "url":"^http://www\\.geocities\\.jp/nagachan_dx/", | |
| "pageElement":"//p[1]/following-sibling::node()", | |
| "nextLink":"//p/a[child::img[@src=\"../../common_materials/button3.gif\"]]", | |
| "wedata.net.id":74051 | |
| }, | |
| { | |
| "url":"^http://yabejp\\.web\\.fc2\\.com/mahjong/", | |
| "pageElement":"id(\"pagenavi\")/preceding-sibling::*", | |
| "nextLink":"//a[./img[@id=\"Next\"]][not(@href=\"#\")]", | |
| "wedata.net.id":80770 | |
| }, | |
| { | |
| "url":"^http://(www\\.)?xbitlabs\\.com/articles/", | |
| "pageElement":"//form[@class=\"table-contents\"]/preceding-sibling::*[not(@class=\"paging\")]", | |
| "nextLink":"//a[@class='next-page']", | |
| "wedata.net.id":29198 | |
| }, | |
| { | |
| "url":"^http://maoudamashii\\.jokersounds\\.com/", | |
| "pageElement":"//div[@class='mtList']", | |
| "nextLink":"//li[@class='pl02']/a", | |
| "wedata.net.id":77196 | |
| }, | |
| { | |
| "url":"^http://karafuto50\\.blog117\\.fc2\\.com/", | |
| "pageElement":"id(\"main\")/div[contains(concat(\" \", @class, \" \"), \" section \") and not(@id=\"entry\")]", | |
| "nextLink":"id(\"flip2\")/li[@class=\"older\"]/a", | |
| "wedata.net.id":1294 | |
| }, | |
| { | |
| "url":"^https?://bk-mufg\\.jeevessolutions\\.jp/", | |
| "pageElement":"//td[./b]/ancestor::table[1]/preceding-sibling::table[.//tr[@height=\"25\"]]//tr", | |
| "nextLink":"//td[./b]/following-sibling::td[1]/a", | |
| "wedata.net.id":64669 | |
| }, | |
| { | |
| "url":"^http://www\\.dmm\\.co(?:m|\\.jp)/.+=text", | |
| "pageElement":"//div[@class='d-item']/table/tbody/tr[td]", | |
| "nextLink":"//link[@rel='next']", | |
| "wedata.net.id":1256 | |
| }, | |
| { | |
| "url":"^http://www\\.scrapi\\.jp/(?:home|scraps)", | |
| "pageElement":"//div[@class='next-page']/preceding-sibling::*", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":36465 | |
| }, | |
| { | |
| "url":"^http://s\\.marsfinxder\\.jp/[^/]+/search", | |
| "pageElement":"id('mf_results')/lirn", | |
| "nextLink":"//li[@class='mf_nextpage']/a", | |
| "wedata.net.id":55851 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?supercentral\\.org/lk/", | |
| "pageElement":"//div[@class=\"post-cat1\"]", | |
| "nextLink":"id(\"middle\")/div[@class=\"nav\"]/div[@class=\"navold\"]/a[text()]", | |
| "wedata.net.id":678 | |
| }, | |
| { | |
| "url":"^http://(?:suumo.jp|www\\.jj-navi\\.com)/", | |
| "pageElement":"//ul[@class='l-cassetteitem']/li", | |
| "nextLink":"//li[@class='pagination-current']/following-sibling::li[a][1]/a", | |
| "wedata.net.id":29458 | |
| }, | |
| { | |
| "url":"^http://www\\.newsweekjapan\\.jp/picture/", | |
| "pageElement":"id('showCase')", | |
| "nextLink":"//div[@class='next_thumb off']/a", | |
| "wedata.net.id":29928 | |
| }, | |
| { | |
| "url":"^http://kenz0\\.s201\\.xrea\\.com/weblog/", | |
| "pageElement":"id(\"entry\")", | |
| "nextLink":"//div[@class=\"prev\"]/a", | |
| "wedata.net.id":937 | |
| }, | |
| { | |
| "url":"^http://kenbunden\\.net/general/archives/", | |
| "pageElement":"id('content')/article/div[@class='post']/node()|id('content')/article[@class='minientry clearfix']/node()", | |
| "nextLink":"id('page-link')/text()[number(translate(.,'Pages ', '')) > 0]/following-sibling::a|//li[@class='next']/a", | |
| "wedata.net.id":74809 | |
| }, | |
| { | |
| "url":"^http://www\\.webmysteries\\.jp/sakuraba/", | |
| "pageElement":"//div[@class=\"article\"]/div/div/table", | |
| "nextLink":"//link[@rel=\"next bookmark\"]", | |
| "wedata.net.id":62166 | |
| }, | |
| { | |
| "url":"^http://anidb\\.net/perl-bin/animedb\\.pl", | |
| "pageElement":"//table[@class='animelist']//tr[td] | id('top')//div[contains(@class,'comment')] | //ul/li[contains(@class,'row')]", | |
| "nextLink":"//li[@class='next'][1]/a | //div[@class='pagination']//strong/following-sibling::a", | |
| "wedata.net.id":30177 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?meister\\.ne\\.jp/bbs/", | |
| "pageElement":"id(\"contents\")/div[contains(concat(\" \", @class, \" \"), \" message \")]", | |
| "nextLink":"id(\"contents\")/p/a[starts-with(text(), \"NEXT>>\")]", | |
| "wedata.net.id":2750 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?pclab\\.pl/(?:art|tip)", | |
| "pageElement":"//div[@class='main']/div[@class='substance']/div[@class='data']", | |
| "nextLink":"//div[@class='next']/div[@class='link']/a", | |
| "wedata.net.id":53915 | |
| }, | |
| { | |
| "url":"^http://www\\.ams\\.org/mathscinet/search", | |
| "pageElement":"//form[@name=\"batchDownload\"]", | |
| "nextLink":"//a[text()=\"Next\"]", | |
| "wedata.net.id":64293 | |
| }, | |
| { | |
| "url":"^http://www\\.hajou\\.org/infoliberalism/", | |
| "pageElement":"//div[@id='text']", | |
| "nextLink":"id('navigation')/li[not(a)]/following-sibling::li/a", | |
| "wedata.net.id":57734 | |
| }, | |
| { | |
| "url":"^http://rental\\.rakuten\\.jp/search2/\\?", | |
| "pageElement":"//ul[@class='imageListWrapper']/li", | |
| "nextLink":"id('pagingNext')", | |
| "wedata.net.id":2711 | |
| }, | |
| { | |
| "url":"^http://veadardiary\\.blog29\\.fc2\\.com/", | |
| "pageElement":"id(\"main\")/div[contains(concat(\" \", @class, \" \"), \" entry \")]", | |
| "nextLink":"//ul[contains(concat(\" \", @class, \" \"), \" pager \")]/li[contains(concat(\" \", @class, \" \"), \" older \")]/a", | |
| "wedata.net.id":30245 | |
| }, | |
| { | |
| "url":"^http://invariant0\\.blog130\\.fc2\\.com/", | |
| "pageElement":"//div[@class=\"ently_outline\"]", | |
| "nextLink":"//p[@class=\"page_navi\"]/a[starts-with(text(),\"\u6b21\")]", | |
| "wedata.net.id":57513 | |
| }, | |
| { | |
| "url":"^http://hide\\.maruo\\.co\\.jp/lib/macro/", | |
| "pageElement":"//td[@class='mfont']/table[.//img]", | |
| "nextLink":"//a[.='『戻る』']/preceding-sibling::table[position()=1]//td[child::b]/following-sibling::td[position()=1]/a", | |
| "wedata.net.id":2639 | |
| }, | |
| { | |
| "url":"^https://gameofscanlation\\.moe/projects/", | |
| "pageElement":"//div[@class=\"chapterPages\"]", | |
| "nextLink":"//a[@class=\"button comicNextPageUrl\"]", | |
| "wedata.net.id":80837 | |
| }, | |
| { | |
| "url":"^http://www\\.music-eclub\\.com/pasokara/", | |
| "pageElement":"//div[@class=\"list_main\"][1]/following-sibling::div", | |
| "nextLink":"//a[@title=\"次へ\"]", | |
| "wedata.net.id":62467 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?socialnetworking\\.jp/", | |
| "pageElement":"//article", | |
| "nextLink":"//a[@rel='prev']", | |
| "wedata.net.id":931 | |
| }, | |
| { | |
| "url":"^http://game\\.watch\\.impress\\.co\\.jp/", | |
| "pageElement":"//div[@class=\"main-contents mainContents\"]/div[@class=\"contents-section contents-section-layer-1\"]/*[not(@class) or (@class!=\"tab-wrap\")]", | |
| "nextLink":"//li[@class=\"next\"]/a", | |
| "wedata.net.id":66684 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?whitepages\\.com\\.au/", | |
| "pageElement":"//div[@class='resultItems']/div", | |
| "nextLink":"//span[contains(@class,'CurrentPage')]/following-sibling::a[1]", | |
| "wedata.net.id":2589 | |
| }, | |
| { | |
| "url":"^http://bylines\\.news\\.yahoo\\.co\\.jp/", | |
| "pageElement":"//div[@class=\"listBody\"]", | |
| "nextLink":"//li[@class=\"next\"]/a", | |
| "wedata.net.id":77698 | |
| }, | |
| { | |
| "url":"^https://search-voi\\.0101\\.co\\.jp/voi/", | |
| "pageElement":"id('rightPanel')/ul", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":30684 | |
| }, | |
| { | |
| "url":"^https?://www\\.amazon\\.com/best-sellers", | |
| "pageElement":"id('zg_centerListWrapper')/*[not(@id='zg_paginationWrapper')]", | |
| "nextLink":"//li[contains(@class,'zg_selected')]/following-sibling::li[1]/a", | |
| "wedata.net.id":77705 | |
| }, | |
| { | |
| "url":"^http://websearch\\.rakuten\\.co\\.jp/Web", | |
| "pageElement":"//ul[@class=\"os-result\"]", | |
| "nextLink":"//a[@class=\"next-sc-page-serp\"]", | |
| "wedata.net.id":72667 | |
| }, | |
| { | |
| "url":"^http://search\\.vector\\.co\\.jp/vsearch", | |
| "pageElement":"//div[@class=\"result section\"]", | |
| "nextLink":"//span[@class=\"current\"]/following-sibling::a", | |
| "wedata.net.id":2422 | |
| }, | |
| { | |
| "url":"^http://www\\.bookservice\\.jp/SearchItem", | |
| "pageElement":"//div[@class='item']", | |
| "nextLink":"//li[a/@class='act']/following-sibling::li[1]/a", | |
| "wedata.net.id":74954 | |
| }, | |
| { | |
| "url":"^http://www\\.tinkle\\.co\\.jp/jobsearch/", | |
| "pageElement":"//div[@class=\"shop_list\"]", | |
| "nextLink":"//link[@rel=\"next\"]", | |
| "wedata.net.id":55866 | |
| }, | |
| { | |
| "url":"^http://clip\\.eventcast\\.jp/(?:recent)?", | |
| "pageElement":"id(\"contents\")/div[@class=\"event-list\" and last()]/div", | |
| "nextLink":"//p[@class=\"more\"]/a[last() and contains(text(),\"\u65b0\u7740\")] | //div[contains(concat(\" \",@class,\" \"),\" pager \")]/a[last() and contains(concat(\" \",@class,\" \"),\" next \")]", | |
| "wedata.net.id":2348 | |
| }, | |
| { | |
| "url":"^http://www\\.adobe\\.com/(?:jp/)?devnet/", | |
| "pageElement":"//div[@class=\"LayoutCellSides\"]/div", | |
| "nextLink":"//a[contains(@class,\"LinkBoxInvert\")]/following-sibling::a[1]", | |
| "wedata.net.id":413 | |
| }, | |
| { | |
| "url":"^http://www\\.rankbank\\.net/amaran/rank/", | |
| "pageElement":"//table[@class=\"ta\"]/parent::td/*[(self::table and @class=\"ta\" and ./tbody/tr/td[@class=\"rank\"]) or (self::br)]", | |
| "nextLink":"//a[@class=\"selected\"]/parent::td/following-sibling::td[1]/a[@class=\"noselected\"]", | |
| "wedata.net.id":2289 | |
| }, | |
| { | |
| "url":"^http://www\\.zdf\\.de/form/globale-suche", | |
| "pageElement":"//div[@class='cbox_wrap']/div[@class='cbox grey clearfix ']", | |
| "nextLink":"//a[@title='weiter']", | |
| "wedata.net.id":32528 | |
| }, | |
| { | |
| "url":"^http://web-tan\\.forum\\.impressrd\\.jp/", | |
| "pageElement":"id('block-system-main')//div[@class='field-item even']/*[not(@id='next_page_link_auto' or @class='next_page' or contains(@src,'arrow.gif'))]|//div[@class='view-header']/following-sibling::div[@class='view-content']//ul/li|//div[@class='node-title-set'][not(id('block-system-main')//ul[@class='pager']) or id('block-system-main')//li[@class='pager-current']/span=1]", | |
| "nextLink":"//*[@class='pager-next last' or @class='node_article_next']/a", | |
| "wedata.net.id":2194 | |
| }, | |
| { | |
| "url":"http://www\\.digitalartsonline\\.co\\.uk/", | |
| "pageElement":"//section[@class='listingGrid']/ul", | |
| "nextLink":"//span[@class='activePage']/following-sibling::a", | |
| "wedata.net.id":76959 | |
| }, | |
| { | |
| "url":"^http://headlines\\.yahoo\\.co\\.jp/list/", | |
| "pageElement":"id('main')/div[contains(@class,'ymuiContainer')]/ul[li]", | |
| "nextLink":"//link[@rel='next']", | |
| "wedata.net.id":77768 | |
| }, | |
| { | |
| "url":"^http://kaisun1192\\.blog121\\.fc2\\.com/", | |
| "pageElement":"//div[contains(@class, \"entry_unit\")]", | |
| "nextLink":"id(\"navi\")/a[1]", | |
| "wedata.net.id":1807 | |
| }, | |
| { | |
| "url":"^http://websearch\\.rakuten\\.co\\.jp/Web", | |
| "pageElement":"id(\"srMain\")", | |
| "nextLink":"id(\"pagenavi\")/a[@class=\"next_sc_page\"]", | |
| "wedata.net.id":54417 | |
| }, | |
| { | |
| "url":"^http://supportforums\\.blackberry\\.com/", | |
| "pageElement":"//table[@class='lia-list-wide']//tr[td]|//div[@class='lia-linear-display-message-view']", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":32481 | |
| }, | |
| { | |
| "url":"^http://seiga\\.nicovideo\\.jp/manga/list", | |
| "pageElement":"id(\"comic_list\")", | |
| "nextLink":"id('mg_main_column')/div[5]/div/ul/li[12]/a", | |
| "wedata.net.id":74696 | |
| }, | |
| { | |
| "url":"^http://bithumen\\.(?:be|ru)/browse\\.php", | |
| "pageElement":"/html/body/p/table[@class=\"mainouter\"]/tbody/tr[2]/td[@class=\"outer\"]/table[@id=\"main\"]/tbody/tr/td[@id=\"maintd\"]/center[2]/table[@id=\"torrenttable\"]", | |
| "nextLink":"/html/body/p/table[@class=\"mainouter\"]/tbody/tr[2]/td[@class=\"outer\"]/table[@id=\"main\"]/tbody/tr/td[@id=\"maintd\"]/div[@id=\"pagertop_container\"]/table[@id=\"pagertop\"]/tbody/tr/td[2]/p/a[contains(.,\"Tov\u00e1bb\")]", | |
| "wedata.net.id":56775 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?free4uwallpapers\\.nl/", | |
| "pageElement":"//img[@class=\"img_box\"]/ancestor::table[1][@width=\"500px\"]", | |
| "nextLink":"//img[@src=\"http://www.free4uwallpapers.nl/images/next_pg.png\"]/parent::a", | |
| "wedata.net.id":32464 | |
| }, | |
| { | |
| "url":"^https://developer\\.apple\\.com/library/", | |
| "pageElement":"id('contents')//section", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":77839 | |
| }, | |
| { | |
| "url":"^http://blog\\.hatena\\.ne\\.jp/-/antenna", | |
| "pageElement":"//li[@class=\"entry-unit\"]", | |
| "nextLink":"//a[contains(text(),\"次のページ\")]", | |
| "wedata.net.id":74642 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?manga\\.animea\\.net/.", | |
| "pageElement":"//div[@class=\"maincontent_mr\"]/table//tr", | |
| "nextLink":"//td[@class=\"scan\"]/a[not(@href=\"#\")]", | |
| "wedata.net.id":31342 | |
| }, | |
| { | |
| "url":"^https://freegame-mugen\\.jp/roleplaying/", | |
| "pageElement":"id('catalog')/li", | |
| "nextLink":"//a[.='次のページ']", | |
| "wedata.net.id":31600 | |
| }, | |
| { | |
| "url":"^https://aws\\.amazon\\.com/marketplace/*", | |
| "pageElement":"//div[@class='search-result-row']", | |
| "nextLink":"//div[@class='pagination-element selected']/following-sibling::div[1]/a", | |
| "wedata.net.id":74895 | |
| }, | |
| { | |
| "url":"http://aozoragakuen\\.sakura\\.ne\\.jp/.+", | |
| "pageElement":"descendant::br[1]/following-sibling::node()[not(self::address)]", | |
| "nextLink":"//a[img/@alt='next']", | |
| "wedata.net.id":76830 | |
| }, | |
| { | |
| "url":"^http://[^.]+\\.ap\\.teacup\\.com/[^/]+/$", | |
| "pageElement":"//div[@class='content']/*[@class='menuRight']/preceding-sibling::*", | |
| "nextLink":"//div[@class='menuRight']/a[last()]", | |
| "wedata.net.id":1981 | |
| }, | |
| { | |
| "url":"^http://www\\.webdoku\\.jp/column/takano/", | |
| "pageElement":"//div[@class='contentNavi']/following-sibling::*[following-sibling::div/@class='contentNavi']", | |
| "nextLink":"//link[contains(@rel,'next')]", | |
| "wedata.net.id":66503 | |
| }, | |
| { | |
| "url":"^http://www\\.ftext\\.org/text/section/.+", | |
| "pageElement":"id('content-wrapper')/*[preceding-sibling::ul/@id='page-breadcrumb-demo'][following-sibling::ul/@class='pager']", | |
| "nextLink":"//a[@class='btn btn-primary']", | |
| "wedata.net.id":76829 | |
| }, | |
| { | |
| "url":"^https://www\\.bridalnet\\.co\\.jp/search", | |
| "pageElement":"//div[@class=\"trend-list-box clearfix\"]|//div[@class=\"trend-list-box clearfix\"]/following-sibling::a", | |
| "nextLink":"//div[@class='pageSending f-right mb30']/ul/li/strong/following-sibling::a[1]", | |
| "wedata.net.id":74884 | |
| }, | |
| { | |
| "url":"^http://(?:book|www)\\.dmm\\.co(?:m|.jp)/", | |
| "pageElement":"//ul[@id=\"fn-list\"]/li", | |
| "nextLink":"//ul[@class=\"m-boxPagenation__list\"]/li[span]/following-sibling::li/a", | |
| "wedata.net.id":79970 | |
| }, | |
| { | |
| "url":"^http://www\\.museum\\.or\\.jp/(MS|event)", | |
| "pageElement":"//table[@class='result']", | |
| "nextLink":"//a[@class='pager-next active' and contains(text(),'次')]", | |
| "wedata.net.id":76828 | |
| }, | |
| { | |
| "url":"^http://(?!www)(?:[^.]+\\.)?fooooo\\.com/", | |
| "pageElement":"//dl[@class='clearfix']/*", | |
| "nextLink":"//li[a/@class='selected']/following-sibling::li[1]/a", | |
| "wedata.net.id":1920 | |
| }, | |
| { | |
| "url":"^http://www\\.techpowerup\\.com/articles/", | |
| "pageElement":"//div[@class='review']", | |
| "nextLink":"//article[@class=\"content article\"]//div[@style=\"float:right\"]/a", | |
| "wedata.net.id":76497 | |
| }, | |
| { | |
| "url":"^http://yaruomatome\\.blog10\\.fc2\\.com/", | |
| "pageElement":"//div[@class=\"ently_outline\" or @class=\"comment_outline\" or @class=\"trackback_outline\"]", | |
| "nextLink":"//p[@class=\"page_navi\"]/a[contains(@title,\"\u6b21\u30da\u30fc\u30b8\")]", | |
| "wedata.net.id":1859 | |
| }, | |
| { | |
| "url":"^http://labola.jp/(?:community|recruits)/", | |
| "pageElement":"//table[@class=\"list\"]//tr[td] | //div[@class=\"com_diary_push\"]//tr[not(@class)]", | |
| "nextLink":"//div[@class=\"new_pager\"]/span[@class=\"on\"]/following-sibling::a[last()]", | |
| "wedata.net.id":32062 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?laptopvideo2go\\.com/", | |
| "pageElement":"id('download_drivers')/tbody/tr", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":55638 | |
| }, | |
| { | |
| "url":"^http://www\\.tastefullyoffensive\\.com/", | |
| "pageElement":"//div[@class='post-outer']", | |
| "nextLink":"id('Blog1_blog-pager-older-link')", | |
| "wedata.net.id":76947 | |
| }, | |
| { | |
| "url":"^http://portal\\.nifty\\.com/cs/catalog/", | |
| "pageElement":"//div[@class='entry']", | |
| "nextLink":"//li[@class='nex']/a", | |
| "wedata.net.id":27404 | |
| }, | |
| { | |
| "url":"^http://forbesjapan.com/articles/detail/", | |
| "pageElement":"//div[@class=\"kizi-honbun\"]", | |
| "nextLink":"//div[@class=\"inner-title\"]/a", | |
| "wedata.net.id":80993 | |
| }, | |
| { | |
| "url":"^http://forums\\.philosophyforums\\.com/", | |
| "pageElement":"//table//tr[td[@class='titlecolumn' or starts-with(@class,'commentposter')]]", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":67269 | |
| }, | |
| { | |
| "url":"^http://hatenablog\\.com/g/-/category/.+", | |
| "pageElement":"//ul[@class='list circle-list section']/li", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":72773 | |
| }, | |
| { | |
| "url":"^http://ktcom\\.jp/database/search\\.cgi", | |
| "pageElement":"//table[@bordercolorlight and @bordercolordark]/tbody/tr", | |
| "nextLink":"//table[@bordercolorlight and @bordercolordark]/preceding-sibling::div[1]/a[last()][not(./following-sibling::font)]", | |
| "wedata.net.id":77347 | |
| }, | |
| { | |
| "url":"^http://iphone-rejectdb\\.appspot\\.com/", | |
| "pageElement":"//tr[td]", | |
| "nextLink":"id(\"main\")/div[@class=\"index\"]/node()[not(self::a) and (number(self::text())>0)]/following-sibling::a[1]", | |
| "wedata.net.id":27152 | |
| }, | |
| { | |
| "url":"^http://shchara\\.co\\.jp/07event/comic/", | |
| "pageElement":"//tr[td/a/img]", | |
| "nextLink":"//td/a[img]", | |
| "wedata.net.id":52787 | |
| }, | |
| { | |
| "url":"^http://nico-kawai\\.com/(?:work|diary)/", | |
| "pageElement":"//section", | |
| "nextLink":"//li[@class=\"previous\"]/a", | |
| "wedata.net.id":73838 | |
| }, | |
| { | |
| "url":"^http://erojanai2?\\.karinto\\.in/[23]d/", | |
| "pageElement":"//table[@align='right']/preceding-sibling::node()", | |
| "nextLink":"//table[@align='right']/following-sibling::table[1]//tr/form[@action][last()]", | |
| "wedata.net.id":64735 | |
| }, | |
| { | |
| "url":"^http://coderepos\\.org/share/changeset/", | |
| "pageElement":"id('content')", | |
| "nextLink":"//link[@rel='prev']", | |
| "wedata.net.id":439 | |
| }, | |
| { | |
| "url":"^http://.+\\.travel\\.rakuten\\.co\\.jp/", | |
| "pageElement":"id('result')/div[@class='hotelBox']", | |
| "nextLink":"//li[@class='pagingBack']/a", | |
| "wedata.net.id":27144 | |
| }, | |
| { | |
| "url":"^http://demae-can\\.com/search/delivery/", | |
| "pageElement":"id('ma_delivery_body_pager')/div[not(@class='page_navi' or @id='ma_delivery_body_sort' or @class='clearboth')]", | |
| "nextLink":"id('ma_delivery_body_pager')/div[@class='page_navi']/a[contains(.,'>')]", | |
| "wedata.net.id":26771 | |
| }, | |
| { | |
| "url":"^http://b\\.hatena\\.ne\\.jp/apps/iphone", | |
| "pageElement":"//ul[@class='hotentry hotasin show_detail hotits']/li", | |
| "nextLink":"//a[@class='pager-next']", | |
| "wedata.net.id":48319 | |
| }, | |
| { | |
| "url":"^https?://mail\\.google\\.com/mail/[hx]/", | |
| "pageElement":"//div[@class='email read']", | |
| "nextLink":"id('tho')[.='Older >']", | |
| "wedata.net.id":28915 | |
| }, | |
| { | |
| "url":"^http://rfonlinez\\.sns\\-park\\.com/\\?", | |
| "pageElement":"//div[@class='parts']/dl", | |
| "nextLink":"//a[contains(.,'次を表示')]", | |
| "wedata.net.id":46955 | |
| }, | |
| { | |
| "url":"^http://(bbs|review)\\.kakaku\\.com/\\1/", | |
| "pageElement":"id('mainLeft')/p/preceding-sibling::div[descendant-or-self::*[contains(@class,'Box')]]", | |
| "nextLink":"id('NAVI_TBL mainLeft')/p/a[starts-with(.,'次の')]", | |
| "wedata.net.id":761 | |
| }, | |
| { | |
| "url":"^http://urakaryu08\\.blog51\\.fc2\\.com/", | |
| "pageElement":"id(\"MAIN\")", | |
| "nextLink":"id(\"NAVI\")/ul/li[last()]/a", | |
| "wedata.net.id":29065 | |
| }, | |
| { | |
| "url":"^http://(?:[^.]+\\.)?slickdeals\\.net/.+", | |
| "pageElement":"//div[@class='dealRow']|id('deals')/div[.//@class='itemBottomRow']", | |
| "nextLink":"//a[@class='button'][.='Next']", | |
| "wedata.net.id":29177 | |
| }, | |
| { | |
| "url":"^http://spankingfm\\.blog13\\.fc2\\.com/", | |
| "pageElement":"//div[contains(concat(\" \", @class, \" \"), \" contents \")]/div[contains(concat(\" \", @class, \" \"), \" entry_box \")]", | |
| "nextLink":"//div[contains(concat(\" \", @class, \" \"), \" contents \")]/p/a[last()][not(@href=\"#PAGETOP\")]", | |
| "wedata.net.id":46147 | |
| }, | |
| { | |
| "url":"^http://ironman\\.enlightenedperl\\.org/", | |
| "pageElement":"id(\"main\")/*[self::div and @class=\"entry\" or self::a and @name]", | |
| "nextLink":"id(\"main\")/span[@class=\"nav\"]/a[contains(., \">\")]", | |
| "wedata.net.id":29342 | |
| }, | |
| { | |
| "url":"^http://blog\\.goo\\.ne\\.jp/yukoyajima/", | |
| "pageElement":"//div[@class='mod-entry-set']", | |
| "nextLink":"//li[@class='mod-pre-nex-prev']/a", | |
| "wedata.net.id":26651 | |
| }, | |
| { | |
| "url":"^https?://(?:konachan\\.com|yande\\.re)/", | |
| "pageElement":"id(\"post-list-posts\")/li|id(\"comment-list\")/div[@class=\"post\"]|//table[@class=\"highlightable\"]//tr", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":74645 | |
| }, | |
| { | |
| "url":"^http://www\\.kobe-np\\.co\\.jp/rentoku/", | |
| "pageElement":"//div[@class=\"genreTitle\"][1]/following-sibling::*[following-sibling::div[@class=\"ad text_l\"]]", | |
| "nextLink":"//ul[contains(@class,\"newsDescription_type02\")]/li[not(position()=1)][./a[contains(text(),concat(\"(\",substring-before(substring-after(//title/text(),\"(\"),\")\"),\")\"))]]/preceding-sibling::li[1]/a[not(@href=\"#\")]|//ul[contains(@class,\"newsDescription_type02\")][./li[1][./a[contains(text(),concat(\"(\",substring-before(substring-after(//title/text(),\"(\"),\")\"),\")\"))]]]/preceding-sibling::ul[1]/li[last()]/a[not(@href=\"#\")]", | |
| "wedata.net.id":55268 | |
| }, | |
| { | |
| "url":"^http://hadakadenkyu\\.flnet\\.org/blog/", | |
| "pageElement":"id(\"blog_article\")", | |
| "nextLink":"id(\"title_area\")/a[1]", | |
| "wedata.net.id":930 | |
| }, | |
| { | |
| "url":"^http://(www|shigoto)\\.nikki\\.ne\\.jp/", | |
| "pageElement":"//ul[@class='normal']/li", | |
| "nextLink":"//div[@align='right']/b[font/@color='#cc6600']/following-sibling::b/font/a", | |
| "wedata.net.id":29588 | |
| }, | |
| { | |
| "url":"http://(7his|4qps|freetubehd|tubeel).com", | |
| "pageElement":"//div[@class=\"all_items\"]/div[@class=\"item\"]", | |
| "nextLink":"//ul[@class=\\\"pagination\\\"]/li[last()]/a", | |
| "wedata.net.id":77521 | |
| }, | |
| { | |
| "url":"^https://novel\\.syosetu\\.org/\\d+/\\d+", | |
| "pageElement":"//div[@id=\"maind\"]", | |
| "nextLink":"//a[contains(text(),\"次の話\")][last()]", | |
| "wedata.net.id":80769 | |
| }, | |
| { | |
| "url":"^http://nanigashi3\\.blog40\\.fc2\\.com/", | |
| "pageElement":"//div[@id=\"mainEntryBlock\" and not(.//div[@id=\"googleAdContainer\"])]/*", | |
| "nextLink":"id(\"pageLink\")//a[contains(., \"\u226b\")]", | |
| "wedata.net.id":1524 | |
| }, | |
| { | |
| "url":"^http://jbpress\\.ismedia\\.jp/articles/", | |
| "pageElement":"//div[contains(@class,'main-column')]/div[@class='editors-select']/preceding-sibling::div[not(@class='article-next clearfix')]", | |
| "nextLink":"//span[@class='next-smr']/a", | |
| "wedata.net.id":77043 | |
| }, | |
| { | |
| "url":"^http://style-cruise\\.jp/itemsrch\\.php", | |
| "pageElement":"//ul[@class='clr']/li", | |
| "nextLink":"//li[@class=\"arrow right\"]/a", | |
| "wedata.net.id":55380 | |
| }, | |
| { | |
| "url":"^http://(?:aurasoul\\.)?mb2\\.jp/_[^/]+/", | |
| "pageElement":"//table[@class='table2 bbs']/tbody/tr[td]|id('RES')/*[not(@class='d_ryaku')]", | |
| "nextLink":"(//span[@class='comoji']|//strong)[.//@class='red']/following-sibling::a[1]", | |
| "wedata.net.id":25722 | |
| }, | |
| { | |
| "url":"^https?://sportiva\\.shueisha\\.co\\.jp/", | |
| "pageElement":"//main[@role=\"main\"]/div[contains(@class,\"block-list\")]|//div[contains(@class,\"mod-post\")]/p", | |
| "nextLink":"//p[contains(@class,\"js-current\")]/following-sibling::a", | |
| "wedata.net.id":40460 | |
| }, | |
| { | |
| "url":"^http://www53\\.atwiki\\.jp/kakuo/pages/", | |
| "pageElement":"id('wikibody')/table", | |
| "nextLink":"id('wikibody')/div/a[2]", | |
| "wedata.net.id":74729 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?miyata-net\\.co\\.jp/", | |
| "pageElement":"//div[@class=\"pro_list\"]", | |
| "nextLink":"//li[@class=\"page_right\"]/a", | |
| "wedata.net.id":40005 | |
| }, | |
| { | |
| "url":"^http://www\\.showbiz411\\.com/category/", | |
| "pageElement":"//div[@class='wpb_row row-fluid']", | |
| "nextLink":"//a[img/@class='td_retina right-arrow']", | |
| "wedata.net.id":77021 | |
| }, | |
| { | |
| "url":"^http://(?:up[0-9]+\\.)?viploader\\.net/", | |
| "insertBefore":"//small/center", | |
| "pageElement":"//table[@summary=\"upinfo\"]", | |
| "nextLink":"//small/small/text()[string-length(normalize-space()) > 1]/following-sibling::a[1]", | |
| "wedata.net.id":30317 | |
| }, | |
| { | |
| "url":"^http://java\\.main\\.jp/gem/847631/bbs/", | |
| "pageElement":"//table[@class=\"kiji\"]", | |
| "nextLink":"//a[img/@src=\"http://java.main.jp/gem/847631/bbs/king/images/next_page2.gif\"]", | |
| "wedata.net.id":80678 | |
| }, | |
| { | |
| "url":"^http://www\\.lddb\\.com/search\\.php\\?", | |
| "pageElement":"//tr[starts-with(@class, \"contents_\")]", | |
| "nextLink":"/descendant::td[starts-with(normalize-space(text()), \"Browse:\")][1]/b/following-sibling::a[1]", | |
| "wedata.net.id":30352 | |
| }, | |
| { | |
| "url":"^http://(?:www|sv2)\\.footballista\\.jp/", | |
| "pageElement":"id(\"contents_main\")/article/p[@class=\"txt_body\"]", | |
| "nextLink":"//ul[@class=\"pager\"]/li[@class=\"next\"]/a", | |
| "wedata.net.id":74829 | |
| }, | |
| { | |
| "url":"^http://www\\.mobipicker\\.com/category/", | |
| "pageElement":"//div[@class='td-block-row']", | |
| "nextLink":"//a[i/@class='td-icon-menu-right']", | |
| "wedata.net.id":80660 | |
| }, | |
| { | |
| "url":"^http://cyclerecycle\\.blog\\.fc2\\.com/", | |
| "pageElement":"//div[@class='status'][1]/following-sibling::*[following-sibling::div/@class='mainnavi']", | |
| "nextLink":"//div[@class='mainnavi']/a[.='NEXT']", | |
| "wedata.net.id":64927 | |
| }, | |
| { | |
| "url":"^http://www\\.dhbr\\.net/category/series", | |
| "pageElement":"//div[@class=\"article-list\"]/ul/li", | |
| "nextLink":"//li[@class=\"next\"]/a", | |
| "wedata.net.id":74849 | |
| }, | |
| { | |
| "url":"^http://www\\.chainreactioncycles\\.com/", | |
| "pageElement":"//div[@class='grid_view_row']", | |
| "nextLink":"//div[@class='pagination']/a[@class='active']/following-sibling::a[1]", | |
| "wedata.net.id":39226 | |
| }, | |
| { | |
| "url":"^http://zaxon\\.80code\\.com/tmp/novels/", | |
| "insertBefore":"//divt", | |
| "pageElement":"//center[2]/table/tbody/tr/td/div/preceding-sibling::node()", | |
| "nextLink":"//a[@class]", | |
| "wedata.net.id":63148 | |
| }, | |
| { | |
| "url":"^http://blog\\.domesoccer\\.jp/archives/", | |
| "pageElement":"id('post')/section[1]", | |
| "nextLink":"//p[contains(@class,'paging')]/a[./i[@class='fa fa-chevron-circle-right']]", | |
| "wedata.net.id":77552 | |
| }, | |
| { | |
| "url":"^http://[^.]+\\.ign\\.com/(articles|top)", | |
| "pageElement":"//div[@class=\"article_content\" or @class=\"article-content\"]/*[not(@class=\"prev-page icon-pointy-back\" or (@class='img-div ' and contains(a/img/@src,'nextgame_button')) or @class='accentDivider' or @class='aligncenter')]|id('topnitem topnitem_body')", | |
| "nextLink":"//a[starts-with(.,'Next')]", | |
| "wedata.net.id":25680 | |
| }, | |
| { | |
| "url":"^http://[^.]+\\.blog\\.shinobi\\.jp/hoge", | |
| "insertBefore":"//table[@class=\"main_naka\"]/tbody/tr/td/table/tbody/tr/td/form/table/tbody/tr[last()]", | |
| "pageElement":"//table[@class=\"main_naka\"]/tbody/tr/td/table/tbody/tr/td/form/table/tbody/tr|id('delform')/table/tbody/tr", | |
| "nextLink":"//a[.='次のページ']", | |
| "wedata.net.id":25679 | |
| }, | |
| { | |
| "url":"^http://www\\.[fc]g-site\\.net/archives/", | |
| "pageElement":"//ul[@class='post_work']/li", | |
| "nextLink":"//div[@class=\"pagenavi_simple\"][1]/a[last()-1][not(contains(@href,number(substring-after(//div[@class=\"pagenavi_simple\"][1]/a[last()]/@href,\"?page=\"))-1))]", | |
| "wedata.net.id":25630 | |
| }, | |
| { | |
| "url":"^http://urban-decay\\.livejournal\\.com/", | |
| "pageElement":"id(\"whole\")//table[@class=\"main\"]//td[ancestor::table[1][@class='main']]/table//tr", | |
| "nextLink":"//p[@align='center']/a[contains(.,'Previous')]", | |
| "wedata.net.id":55489 | |
| }, | |
| { | |
| "url":"^http://[^.]+\\.blog\\.so-net\\.ne\\.jp/", | |
| "pageElement":"id(\"main\")/div[starts-with(@class,\"articles\")]", | |
| "nextLink":"//span[@class=\"previousLink\"]/a", | |
| "wedata.net.id":1850 | |
| }, | |
| { | |
| "url":"^http://news23vip\\.blog109\\.fc2\\.com/", | |
| "pageElement":"id(\"main_block\")/div[contains(@class,\"entry_block\")]", | |
| "nextLink":"//div[@class=\"pnavi\"]/a[last()]", | |
| "wedata.net.id":1872 | |
| }, | |
| { | |
| "url":"^http://yahoo-mbga\\.jp/group/\\d+/topic", | |
| "pageElement":"id(\"mainbox-sec\")/div/div[@class=\"crcltopiclist-lay\" or @class=\"crcltopicdetail-lay\"]/div[@class=\"new-topic-lay\" or @class=\"txt1-box\"]/ul", | |
| "nextLink":"id(\"mainbox-sec\")/div/div/div[@class=\"paging-lay\"]/ul/li[last()]/a", | |
| "wedata.net.id":38319 | |
| }, | |
| { | |
| "url":"^http://hatenanews\\.com/articles/column", | |
| "pageElement":"//ul[@class='archive-list type']/li", | |
| "nextLink":"//a[@class='pager-next']", | |
| "wedata.net.id":55509 | |
| }, | |
| { | |
| "url":"^http://(?:[^.]+\\.)?steampowered\\.com/", | |
| "pageElement":"id(\"search_result_container\")/div/a", | |
| "nextLink":"id(\"search_result_container\")/descendant::div[@class=\"search_pagination_right\"]/a[last()]", | |
| "wedata.net.id":1929 | |
| }, | |
| { | |
| "url":"^http://www1\\.ezbbs\\.net/19/dslender2/", | |
| "pageElement":"//form/center[1]/table/tbody/tr[td/a]", | |
| "nextLink":"//form/b/following-sibling::a", | |
| "wedata.net.id":30850 | |
| }, | |
| { | |
| "url":"^http://timesofindia\\.indiatimes\\.com/", | |
| "pageElement":"//div[@id='fsts']", | |
| "nextLink":"//link[@rel=\"next\"]", | |
| "wedata.net.id":79975 | |
| }, | |
| { | |
| "url":"^http://www\\.nhk\\.or\\.jp/ashita-blog/", | |
| "pageElement":"id(\"header\")/following-sibling::node()", | |
| "nextLink":"//img[@class=\"navleft\"]/parent::a", | |
| "wedata.net.id":62713 | |
| }, | |
| { | |
| "url":"^http://woman\\.infoseek\\.co\\.jp/news/", | |
| "pageElement":"id('article_story')/*|//li[@class='news-item']", | |
| "nextLink":"//li[@class='button active']/following-sibling::li[1]/a", | |
| "wedata.net.id":76927 | |
| }, | |
| { | |
| "url":"^http://novel\\.fc2\\.com/novel\\.php\\?", | |
| "pageElement":"//div[@class='main_body']/ul/li[@class='novel_text']/node()", | |
| "nextLink":"//div[@class='main_body']/ul/li[@class='novel_navi2']/a[img/@title='次の小説ページへ']", | |
| "wedata.net.id":36033 | |
| }, | |
| { | |
| "url":"^https://www.linux-apps.com/browse/ord/*", | |
| "pageElement":"//div[@class='product-list']/*", | |
| "nextLink":"//li[@class='next ']/a", | |
| "wedata.net.id":76913 | |
| }, | |
| { | |
| "url":"^http://club\\.kdnet\\.net/dispbbs\\.asp", | |
| "pageElement":"//div[@class='list-table']//tr[td]|//div[starts-with(@class,'reply-box')]", | |
| "nextLink":"//a[text()='下一页']", | |
| "wedata.net.id":74993 | |
| }, | |
| { | |
| "url":"^http://movapic\\.com/(?:[^/]+/)?pic/\\d", | |
| "pageElement":"id('content')/div[@class='black']/node()[@class='picdetail' or self::br]", | |
| "nextLink":"id('imageNavi')//td[@class='preNavi']/a", | |
| "wedata.net.id":31383 | |
| }, | |
| { | |
| "url":"^http://dengekionline\\.com/comic-trial/", | |
| "pageElement":"//table", | |
| "nextLink":"//div/p[not(a)]/following-sibling::p/a", | |
| "wedata.net.id":76806 | |
| }, | |
| { | |
| "url":"http://ameblo\\.jp/.+/imagelist.+\\.html", | |
| "pageElement":"id('imgList')/li", | |
| "nextLink":"id('topNavMonth')/li[a/@class='nowMonth']/preceding-sibling::li[1]/a|//li[@class='prevYear']/a[not(//li[a/@class='nowMonth']/preceding-sibling::li[1]/a)]", | |
| "wedata.net.id":76713 | |
| }, | |
| { | |
| "url":"^http://(.*)\\.bookoff-online\\.jp/blog/", | |
| "pageElement":"//*[@class='post']", | |
| "nextLink":"id('container')/div[@class='navigation']/a", | |
| "wedata.net.id":32121 | |
| }, | |
| { | |
| "url":"^http://(?:[^./]+\\.)?blog\\.ihned\\.cz/", | |
| "pageElement":" tid(\"main\")/descendant::div[contains(concat(\" \", @class, \" \"), \" ow-rub \")]", | |
| "nextLink":"//div[contains(concat(\" \", @class, \" \"), \" next \")]/a[@title=\"další\"]", | |
| "wedata.net.id":55965 | |
| }, | |
| { | |
| "url":"^http://articles\\.chicagotribune\\.com/", | |
| "pageElement":"//div[starts-with(@id,'mod-a-body-') or starts-with(@id,'mod-kp-listing')]", | |
| "nextLink":"id('mod-pagination')//a[contains(.,'Next')]", | |
| "wedata.net.id":32394 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?movie\\.sanook\\.com/", | |
| "pageElement":"//div[@class='cover-list']", | |
| "nextLink":"//div[@class='ugc-paging']/p/span[last()]/following-sibling::a[1]", | |
| "wedata.net.id":35207 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?gaagle\\.jp/gagazine/", | |
| "pageElement":"//div[@class='pager']/preceding-sibling::*", | |
| "nextLink":"//div[@class='pager']/b[1]/following-sibling::a[1] | id('fp1')/a", | |
| "wedata.net.id":34754 | |
| }, | |
| { | |
| "url":"^http://chaton\\.practical-scheme\\.net/", | |
| "pageElement":"id(\"archive-view\")", | |
| "nextLink":"//td[@class=\"to-next\"]/a", | |
| "wedata.net.id":32410 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?hotexpress\\.co\\.jp/", | |
| "pageElement":"//td[contains(@class,'articl_color')]/*[last()]/preceding-sibling::node()", | |
| "nextLink":"//a[contains(img/@src,'next_before')]", | |
| "wedata.net.id":2060 | |
| }, | |
| { | |
| "url":"^http://www\\.macports\\.org/ports\\.php", | |
| "pageElement":"id('content')/dl/dd", | |
| "nextLink":"id(\"content\")/p[last()]/b/following-sibling::a[1]", | |
| "wedata.net.id":34552 | |
| }, | |
| { | |
| "url":"^http://seiga\\.nicovideo\\.jp/book/list", | |
| "pageElement":"//li[@class='bk_book_entry']", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":65416 | |
| }, | |
| { | |
| "url":"^http://eiga\\.com/news/\\d{8}/\\d{1,2}/", | |
| "pageElement":"//div[@class='galleryBox']/div|//div[@class='articleBox_n']", | |
| "nextLink":"//li[@class='btFwd']/a|//div[@class='pictBox')]/a", | |
| "wedata.net.id":55875 | |
| }, | |
| { | |
| "url":"^https://pepabo\\.com/recruit/interview/", | |
| "pageElement":"//div[@class='ppb_recruit_interview-section']", | |
| "nextLink":"//div[@class='ppb-posts-paging']/ul/li[span]/following-sibling::li[1]/a", | |
| "wedata.net.id":76245 | |
| }, | |
| { | |
| "url":"^http://wol\\.nikkeibp\\.co\\.jp/article", | |
| "pageElement":"id(\"articleBody\")", | |
| "nextLink":"id(\"pages\")/ul/li[last()]/a", | |
| "wedata.net.id":76464 | |
| }, | |
| { | |
| "url":"^http://websunday\\.net/backstage/[^/]+/", | |
| "pageElement":"id('bn')/preceding-sibling::*", | |
| "nextLink":"//li[@class='prev']/a", | |
| "wedata.net.id":33375 | |
| }, | |
| { | |
| "url":"^http://www\\.houzz\\.(com|jp|com\\.au)/", | |
| "pageElement":"//div[@class='content-row xl']", | |
| "nextLink":"//a[@class='navigation-button next']", | |
| "wedata.net.id":77828 | |
| }, | |
| { | |
| "url":"^http://www\\.nijibox5\\.com/futaget/src", | |
| "pageElement":"//div[./a[contains(@href,\"index.php\")]]/following-sibling::*[following-sibling::table[@border=\"1\"][.//form[@action]]]", | |
| "nextLink":"//table[@border=1]//td/text()[number(translate(.,'[] ',''))>0]/following-sibling::a", | |
| "wedata.net.id":76454 | |
| }, | |
| { | |
| "url":"^https://www\\.aeonnetshop\\.com/shop/.*", | |
| "pageElement":"//div[@class=\"pc2015-memo-body\"]", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":77827 | |
| }, | |
| { | |
| "url":"^https://(forums\\.)?aws\\.amazon\\.com/", | |
| "pageElement":"//div[@class='search-results']/*|//div[@class='item']", | |
| "nextLink":"//span[@class=\"next\"]/a|//b[@style=\"color: #000;\"][count(./following-sibling::a)=1]/following-sibling::a", | |
| "wedata.net.id":32587 | |
| }, | |
| { | |
| "url":"^http://rule34\\.paheal\\.net/post/list/", | |
| "pageElement":"//div[@class=\"shm-thumb thumb\"]", | |
| "nextLink":"id(\"Navigationleft\")//a[last()][not(@href=\"/post/list\")]", | |
| "wedata.net.id":33230 | |
| }, | |
| { | |
| "url":"http://(nakedcamvideos|teencamvideos).me", | |
| "pageElement":"//div[@class=\"content\"]/div[contains(@class,\"post-container\")]", | |
| "nextLink":"//a[(text()=\">\")]", | |
| "wedata.net.id":77704 | |
| }, | |
| { | |
| "url":"^http://www\\.nishinippon\\.co\\.jp/nnp/", | |
| "pageElement":"//ul[@class='NP-articleList']/li", | |
| "nextLink":"//li[@class='next_page']/a", | |
| "wedata.net.id":77779 | |
| }, | |
| { | |
| "url":"^http://(www|suche)\\.sueddeutsche\\.de/", | |
| "pageElement":"//section[@class='body']|//div[@class='entrylist__entry']", | |
| "nextLink":"//a[contains(.,'nächste Seite')]|//li[@class='arrow next']/a", | |
| "wedata.net.id":32751 | |
| }, | |
| { | |
| "url":"^http://www\\.cliki\\.net/site/search\\?", | |
| "pageElement":"id('content-area')/ol/li", | |
| "nextLink":"id('paginator')//a[contains(.,'>')]", | |
| "wedata.net.id":32836 | |
| }, | |
| { | |
| "url":"^https://github\\.com/[^/]+/[^/]+/issues", | |
| "pageElement":"//div[@class='issues-listing']//li", | |
| "nextLink":"//a[@class='next_page']", | |
| "wedata.net.id":76335 | |
| }, | |
| { | |
| "url":"^http://shop\\.gallery2\\.co\\.jp/search", | |
| "pageElement":"//ul[@class='itemList']/li", | |
| "nextLink":"//li[@class='paginationNext']/a", | |
| "wedata.net.id":32934 | |
| }, | |
| { | |
| "url":"^http://kakaku\\.com/item/[^/]+/picture/", | |
| "pageElement":"//table[contains(@class,'imgList')]//tr", | |
| "nextLink":"//a[@class='arrowNext01']", | |
| "wedata.net.id":76340 | |
| }, | |
| { | |
| "url":"^http://blogs\\.wsj\\.com/photojournal/", | |
| "pageElement":"//h1[@class='wsj-article-headline']|//div[@class='module' and div/@class='clearfix nav-prevnextbox']/preceding-sibling::*", | |
| "nextLink":"//a[class='nav-prevnext nav-prevnext-prev']", | |
| "wedata.net.id":63446 | |
| }, | |
| { | |
| "url":"^http://www\\.netadreport\\.com/\\d+\\.", | |
| "pageElement":"id('center')/p[span/a]/preceding-sibling::*", | |
| "nextLink":"id('center')//a[.='次へ']", | |
| "wedata.net.id":32974 | |
| }, | |
| { | |
| "url":"^http://gs\\.dengeki\\.com/suteki/blog/", | |
| "pageElement":"//div[@class='boxBtop']", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":2233 | |
| }, | |
| { | |
| "url":"^http://www\\.eventernote\\.com/actors/", | |
| "pageElement":"//div[contains(@class,\"gb_event_list\")]/ul/li", | |
| "nextLink":"//li[@class=\"next\"]/a", | |
| "wedata.net.id":76354 | |
| }, | |
| { | |
| "url":"^http://uronkarinon\\.blog\\.fc2\\.com*", | |
| "pageElement":"id('main')/div[@class='category'][position()>1]", | |
| "nextLink":"//div[@class='entry_state']/a[last()][not(@href='http://uronkarinon.blog.fc2.com/')][not(@href='#container')]", | |
| "wedata.net.id":76355 | |
| }, | |
| { | |
| "url":"^https?://(?:[^.]+\\.)?flashback\\.org/", | |
| "pageElement":"//tr[td/@class='thead alignc']/following-sibling::tr|id('posts')/*", | |
| "nextLink":"//a[contains(text(),'>')]", | |
| "wedata.net.id":65582 | |
| }, | |
| { | |
| "url":"^http://www\\.libre-pub\\.co\\.jp/blog/", | |
| "pageElement":"//div[@class=\"entry\"]", | |
| "nextLink":"//a[starts-with(text(), \"次ページへ \") or @rel=\"prev\"]", | |
| "wedata.net.id":64147 | |
| }, | |
| { | |
| "url":"^http://animeanime\\.jp/category/[^/]+/", | |
| "pageElement":"//div[starts-with(@id, \"newslistTitle\")]/following-sibling::div[not(@class=\"newslistPaging\")]", | |
| "nextLink":"//a[text()=\"もっと見る\" or text()=\"> 次\"]", | |
| "wedata.net.id":65510 | |
| }, | |
| { | |
| "url":"^http://plaza\\.rakuten\\.co\\.jp/\\w+/", | |
| "pageElement":"id('diarydate')|//div[@class='dTitle titleBar break-word' or @class='lo']", | |
| "nextLink":"//a[.='過去の記事 >']", | |
| "wedata.net.id":2224 | |
| }, | |
| { | |
| "url":"^http://piro\\.sakura\\.ne\\.jp/latest/", | |
| "pageElement":"//div[@class=\"section topic\"]", | |
| "nextLink":"//a[@title=\"Go to next page\"]", | |
| "wedata.net.id":33216 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?1001freefonts\\.com/", | |
| "pageElement":"//ul[@class='fontListingList']/li", | |
| "nextLink":"//a[.='>']", | |
| "wedata.net.id":32713 | |
| }, | |
| { | |
| "url":"^http://blog\\.shueisha\\.net/otsuichi/", | |
| "pageElement":"id(\"mainBox\")/div[contains(@class,\"dateBox\")]", | |
| "nextLink":"id(\"mainBox\")/p[@class=\"nextNews\"]/a", | |
| "wedata.net.id":32603 | |
| }, | |
| { | |
| "url":"^http://select\\.yeeyan\\.org/lists/all", | |
| "pageElement":"//div[@class=\"s_left_l\"]", | |
| "nextLink":"//ul[@class=\"s_page_n clearfix\"]/li[last()]/a[not(@href=\"javascript:void(0)\")]", | |
| "wedata.net.id":33238 | |
| }, | |
| { | |
| "url":"^http://www\\.kurage-bunch\\.com/manga/", | |
| "pageElement":"id(\"manga_area\")//img[not(contains(@src,\"kurage_bunch\") or contains(@src,\"btn\"))]|id(\"title\")", | |
| "nextLink":"//div[@class=\"pn_btn cf\"]/a[last()][./img[contains(@src,\"next\")]]", | |
| "wedata.net.id":76444 | |
| }, | |
| { | |
| "url":"^https://www\\.basicthinking\\.de/blog/", | |
| "pageElement":"id('x-iso-container')", | |
| "nextLink":"//li[span/@class='current']/following-sibling::li[1]/a", | |
| "wedata.net.id":32529 | |
| }, | |
| { | |
| "url":"^http://www\\.computerworld\\.com\\.au/", | |
| "pageElement":"//div[@class='art-body']/p", | |
| "nextLink":"//a[@class='turn next']", | |
| "wedata.net.id":2606 | |
| }, | |
| { | |
| "url":"^http://(?:search\\.)?merumo\\.ne\\.jp/", | |
| "pageElement":"//div[@class=\"genre_table\"]/following-sibling::*[following-sibling::div[@align=\"center\"]]", | |
| "nextLink":"//div[@class=\"pages\"]/ol/li[@class=\"pages_current\"]/following-sibling::li/a", | |
| "wedata.net.id":33266 | |
| }, | |
| { | |
| "url":"^http://(?:www|img)\\.cityheaven\\.net/", | |
| "pageElement":"id(\"contents shopgirls\")/descendant::*[self::*[p or div][contains(concat(\" \", @class, \" \"), \" pager \")] or self::ul[contains(concat(\" \", @class, \" \"), \" paging \")]]/following-sibling::*[following-sibling::ul[contains(concat(\" \", @class, \" \"), \" paging \")]] | id(\"diary_list diary_photo\")/*", | |
| "nextLink":"//a[@title=\"next page\"]", | |
| "wedata.net.id":55749 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?cotosaga\\.com/list/", | |
| "pageElement":"id(\"ev-view\")/div[@class=\"vevent\"]", | |
| "nextLink":"//a[@class=\"next\"]", | |
| "wedata.net.id":2100 | |
| }, | |
| { | |
| "url":"^http://[^.]+\\.mercadolivre\\.com\\.br", | |
| "pageElement":"id('searchResults')/li", | |
| "nextLink":"//li[@class='ch-pagination-current']/following-sibling::li[1]/a", | |
| "wedata.net.id":32514 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?i-programmer\\.info/", | |
| "pageElement":"//div[@class='pagenavbar']/preceding-sibling::*[not(self::div[@class='pagenavcounter'] or self::table/@class='contenttoc')]|//tr[starts-with(@class,'sectiontableentry')]|//td[@class='article_column']/*", | |
| "nextLink":"//div[@class='pagenavbar'][.//a[contains(@href,'?start=1')] or count(.//a)>1]//a[last()]|//a[@title='Next']", | |
| "wedata.net.id":55881 | |
| }, | |
| { | |
| "url":"^http://www\\.ddlvalley\\.(rocks|cool)/", | |
| "pageElement":"id('middle')//*[starts-with(@id,'post-') or self::h2]", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":76487 | |
| }, | |
| { | |
| "url":"^http://gendai\\.ismedia\\.jp/category/", | |
| "pageElement":"//ul[@class=\"column-list\"]/li", | |
| "nextLink":"//div[@class=\"next_p\"]/a", | |
| "wedata.net.id":64060 | |
| }, | |
| { | |
| "url":"^http://medt00lz\\.s59\\.xrea\\.com/wp/", | |
| "pageElement":"//div[@class=\"entry\"]", | |
| "nextLink":"//a[text()=\"Next »\"]", | |
| "wedata.net.id":2623 | |
| }, | |
| { | |
| "url":"^http://www\\.anunturiparticulari\\.ro/", | |
| "pageElement":"//div[@class='anunt']", | |
| "nextLink":"//ul[@class='pagination']/li[a/@style]/following-sibling::li[1]/a", | |
| "wedata.net.id":34589 | |
| }, | |
| { | |
| "url":"^http://(?:[^.]+\\.)?lazygirls\\.info/.", | |
| "pageElement":"//div[starts-with(@class,'gallery-thumb')]", | |
| "nextLink":"//a[@class='btn btn-primary btn-sm'][.='Next']", | |
| "wedata.net.id":2660 | |
| }, | |
| { | |
| "url":"^http://www\\.nintendolife\\.com/forums", | |
| "pageElement":"//ul[@class='forums-list-topics']/li|//article[@class='forum-post']", | |
| "nextLink":"//a[span/@class='icon icon-caret-right']", | |
| "wedata.net.id":77662 | |
| }, | |
| { | |
| "url":"^http://www\\.soccermagazine-zone\\.com", | |
| "pageElement":"id('main_wrap')/section/article", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":74998 | |
| }, | |
| { | |
| "url":"^http://(?:(?:all|n?sfw)\\.)?juvo\\.se/", | |
| "pageElement":"id(\"main images\")/div[@class=\"image\"]", | |
| "nextLink":"id(\"next\")|id(\"center\")/div/span//strong[text()>=0]/following-sibling::*/descendant-or-self::a", | |
| "wedata.net.id":55594 | |
| }, | |
| { | |
| "url":"^http://bbs\\.inter1908\\.net/showtopic", | |
| "pageElement":"id('postsContainer')/table", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":64296 | |
| }, | |
| { | |
| "url":"^https://(?:www\\.)?penny-arcade\\.com/", | |
| "pageElement":"id('comicFrame')/a", | |
| "nextLink":"//li/a[starts-with(@title,'Next')]", | |
| "wedata.net.id":77638 | |
| }, | |
| { | |
| "url":"^http://www\\.propublica\\.org/feature/", | |
| "pageElement":"//div[@class='inside-page-foot']/preceding-sibling::*|//div[@class='inside-page-head']/following-sibling::*", | |
| "nextLink":"//a[.='Next »']", | |
| "wedata.net.id":32282 | |
| }, | |
| { | |
| "url":"^http://18star\\.ncity\\.net/list\\.php", | |
| "pageElement":"//b[contains(text(), \"No.\")]/ancestor::table[1]", | |
| "nextLink":"//a[contains(text(), \">>\")]", | |
| "wedata.net.id":32261 | |
| }, | |
| { | |
| "url":"^http://motormean\\.s58\\.xrea\\.com/b/", | |
| "insertBefore":"//div[contains(concat(\" \", @class, \" \"), \" pagenav \")]/p/a[.=\"›\"]", | |
| "pageElement":"id(\"main\")", | |
| "nextLink":"//div[contains(concat(\" \", @class, \" \"), \" paging \")]/p/a[.=\"›\"]", | |
| "wedata.net.id":55565 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?allday2?\\.(ru|com)/", | |
| "pageElement":"id('portfolio-grid')/li", | |
| "nextLink":"//div[@class=\"navigation\"]/i[last()]/a", | |
| "wedata.net.id":62325 | |
| }, | |
| { | |
| "url":"^http://www\\.dianashoes\\.com/shop/c/.", | |
| "pageElement":"//div[@class='StyleT_Line_']", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":62639 | |
| }, | |
| { | |
| "url":"http://retrowaretv.com/category/shows/*", | |
| "pageElement":"//div[@class='postarea']", | |
| "nextLink":"id('wp_page_numbers')//a[contains(.,'>')]", | |
| "wedata.net.id":76783 | |
| }, | |
| { | |
| "url":"^http://www\\.movatwitter\\.jugem\\.jp/", | |
| "pageElement":"//div[@class='entry_area']", | |
| "nextLink":"//div[@class=\"page_navi\"][count(./a)>1 or ./a[@href=\"http://movatwitter.jugem.jp/?page=1\"]]/a[last()]", | |
| "wedata.net.id":31661 | |
| }, | |
| { | |
| "url":"^https://www\\.kosho\\.or\\.jp/products", | |
| "pageElement":"//div[@class='search_result_list product_list']", | |
| "nextLink":"//p[@class='display_num']/strong/following-sibling::a[1]", | |
| "wedata.net.id":76788 | |
| }, | |
| { | |
| "url":"^https://blog\\.mozilla\\.org/creative/", | |
| "pageElement":"//article", | |
| "nextLink":"//li[@class=\"prev\"]/a", | |
| "wedata.net.id":35375 | |
| }, | |
| { | |
| "url":"^http://www\\.securityfocus\\.com/news/", | |
| "pageElement":"id(\"article\")/span[@class=\"body\"]/prn", | |
| "nextLink":"//span[@class=\"pages\"]/a[text()=\"next\"]", | |
| "wedata.net.id":2765 | |
| }, | |
| { | |
| "url":"^http://strawberry-linux\\.com/catalog/", | |
| "pageElement":"//tr/td/table[@cellpadding='0' and @cellspacing='2']/tbody/tr", | |
| "nextLink":"id('pg')/a[.='次ページ']", | |
| "wedata.net.id":35659 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?wvgazettemail\\.com/", | |
| "pageElement":"//div[@id=\"story-list block\"]", | |
| "nextLink":"//div[@class=\"pagination-alignright\"]/a", | |
| "wedata.net.id":2766 | |
| }, | |
| { | |
| "url":"^http://(?:[^./]+\\.)+anaitgames\\.com/", | |
| "pageElement":"id('newslist')/ul/li|//table[@class='table table-striped']//tr[td]|id('comentarios')/li", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":31145 | |
| }, | |
| { | |
| "url":"^https://www\\.safaribooksonline\\.com/", | |
| "pageElement":"//ul[contains(@class,'results-list')]/li", | |
| "nextLink":"//a[@class='js-next']", | |
| "wedata.net.id":76899 | |
| }, | |
| { | |
| "url":"^http://news\\.walkerplus\\.com/article", | |
| "pageElement":"//div[@class='txt clearfix']/*[not(@class='clearfix ph_fb')]", | |
| "nextLink":"//div[@class='right']/a", | |
| "wedata.net.id":31126 | |
| }, | |
| { | |
| "url":"^http://forum\\.evilmadscientist\\.com/", | |
| "pageElement":"//ul[@class='DataList Discussions']/li", | |
| "nextLink":"//a[@class='Next']", | |
| "wedata.net.id":2020 | |
| }, | |
| { | |
| "url":"^http://pets\\.yahoo\\.co\\.jp/contest/", | |
| "pageElement":"//ul[@class='mdPht']/li", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":31050 | |
| }, | |
| { | |
| "url":"^https?://(www\\.)?doctorvoluptua\\.com", | |
| "pageElement":"//td[@width and @valign=\"top\"]/a[img[@title]]", | |
| "nextLink":"//*[@class=\"nav_bar\" and @align=\"right\"]/a[1]", | |
| "wedata.net.id":77635 | |
| }, | |
| { | |
| "url":"^http://www\\.amazon\\.de/gp/yourstore/", | |
| "pageElement":"//div[@class=\"ys\"]/table[2]/tbody/tr[position()>2]", | |
| "nextLink":"//a[child::img[contains(@src, \"more-results\")]]", | |
| "wedata.net.id":27474 | |
| }, | |
| { | |
| "url":"^http://www\\.vetusware\\.com/category/", | |
| "pageElement":"//div[@class='item']", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":77862 | |
| }, | |
| { | |
| "url":"^http://hatenablog\\.com/k/keywordblog/", | |
| "pageElement":"id(\"related-blog-body\")/article", | |
| "nextLink":"id(\"pager-bottom\")/p[@class=\"pager-inner\"]/a[@class=\"pager-next\"]", | |
| "wedata.net.id":2777 | |
| }, | |
| { | |
| "url":"^http://www\\.afternoonspecial\\.com/.+", | |
| "pageElement":"//div[@class=\"adsense-top-ad\"]/following-sibling::*[following-sibling::div[@class=\"lower-container\"]]", | |
| "nextLink":"//link[@rel=\"next\"]", | |
| "wedata.net.id":77742 | |
| }, | |
| { | |
| "url":"^http://openradar\\.appspot\\.com/page/", | |
| "pageElement":"id(\"content\")/table/tbody/tr[td]", | |
| "nextLink":"id(\"content\")/h1/a[last()]", | |
| "wedata.net.id":36998 | |
| }, | |
| { | |
| "url":"^https?://(?:www\\.)?nekobu\\.com/blog/", | |
| "pageElement":"id('Main')/*[following-sibling::*[contains(concat(' ', normalize-space(@class), ' '), ' pager ')]]", | |
| "nextLink":"id('Main')//*[contains(concat(' ', normalize-space(@class), ' '), ' pager ')]//*[contains(concat(' ', normalize-space(@class), ' '), ' next ')]//a", | |
| "wedata.net.id":77614 | |
| }, | |
| { | |
| "url":"^http://www\\.oricon\\.co\\.jp/special/", | |
| "pageElement":"//div[@class=\"block-card-list block-special-list block-masonry\"]", | |
| "nextLink":"//a[@class=\"pager-next\"]", | |
| "wedata.net.id":66470 | |
| }, | |
| { | |
| "url":"^http://hirotaku\\.fc2web\\.com/mannga/", | |
| "pageElement":"//div/img", | |
| "nextLink":"//a[text()=\"\u6b21\u3078\"]", | |
| "wedata.net.id":25673 | |
| }, | |
| { | |
| "url":"^http://www\\.health\\.ne\\.jp/library/", | |
| "pageElement":"//div[@class=\"alignC\"]", | |
| "nextLink":"//li[@class=\"next\"]/a", | |
| "wedata.net.id":38637 | |
| }, | |
| { | |
| "url":"^http://blog\\.livedoor\\.jp/yakiusoku/", | |
| "pageElement":"id(\"comment-content\")/ol|//div[@class=\"hentry\"]", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":74892 | |
| }, | |
| { | |
| "url":"^http://twwatcher\\.blog20\\.fc2\\.com/", | |
| "pageElement":"//div[@class=\"blog\"]/div[@class=\"blogbody\"]", | |
| "nextLink":"//div[@class=\"pagenavi\"]/a[last()]", | |
| "wedata.net.id":1835 | |
| }, | |
| { | |
| "url":"^http://blog\\.livedoor\\.jp/gundam2ch/", | |
| "pageElement":"//div[@class=\"article-body-more\"]/a[contains(@href,\"amazon\")][1]/preceding-sibling::node()|//a[@name=\"more\"]/preceding-sibling::node()|//div[contains(@class,\"article-header\")][not(//link[@rel=\"next\"])]|id(\"comments-list commentHeading\")|//div[@class=\"autopagerize_page_element\"]", | |
| "nextLink":"//a[@rel=\"prev\"][not(//link[@rel=\"next\"])]|//link[@rel=\"next\"]", | |
| "wedata.net.id":77551 | |
| }, | |
| { | |
| "url":"^http://number\\.bunshun\\.jp/articles/", | |
| "pageElement":"//div[@class=\"single\"]/*[not(@class=\"next-title\")]", | |
| "nextLink":"//a[(text()=\"NEXT >>\")]", | |
| "wedata.net.id":74842 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?flakerecords\\.com/.", | |
| "pageElement":"id(\"itemlist\")/table[1]", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":55434 | |
| }, | |
| { | |
| "url":"^http://www\\.phppro\\.jp/(qa|phptips)/", | |
| "pageElement":"id('q_list')/li|//div[@class='body_txt']/dl/*", | |
| "nextLink":"//a[.='Next >']", | |
| "wedata.net.id":1791 | |
| }, | |
| { | |
| "url":"^http://monahokan\\.web\\.fc2\\.com/aa/", | |
| "pageElement":"//dl[1]", | |
| "nextLink":"//a[contains(concat(\" \",text(),\" \"),\" >> \")]", | |
| "wedata.net.id":66721 | |
| }, | |
| { | |
| "url":"^http://www\\.parenting\\.tw/article/.+", | |
| "pageElement":"//div[@class='articleContent']/*[not(span/@style='color: #ff6600;')]|//li[@class='listItem ']", | |
| "nextLink":"//ul[@class='pagination']/li[@class='active']/following-sibling::li[1]/a[1]", | |
| "wedata.net.id":77546 | |
| }, | |
| { | |
| "url":"^http://garakuta\\.oops\\.jp/wordpress/", | |
| "pageElement":"id('content')/div[contains(@class,'post') or @class='calendar']", | |
| "nextLink":"//div[@class='browse']/a[last()]", | |
| "wedata.net.id":1769 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?bb-nippon\\.com/news", | |
| "pageElement":"//ul[@class=\"list\"]/li|//dl[@class=\"newslist_black\"]|//div[@class=\"article_wrap\"][not(./img[contains(@src,\"icons_twitter\")])]|//img[contains(@src,\"icons_twitter\")]/preceding-sibling::p[1]/preceding-sibling::*", | |
| "nextLink":"//div[@class=\"pagination\"]//li[last()]/a|//dl[@class=\"pagination-article\"]/dd[last()]/a", | |
| "wedata.net.id":77535 | |
| }, | |
| { | |
| "url":"^http://dic\\.nicovideo\\.jp/m/[nu]/res", | |
| "pageElement":"id(\"main\")/div[@class=\"left-box\"][./div[@class=\"article\"]][1]/following-sibling::*[1][self::img]/following-sibling::*[./following-sibling::img/following-sibling::*[1][self:: div and @class=\"left-box\"][./div[@class=\"article\"]]]", | |
| "nextLink":"id(\"main\")//div[@class=\"article\"]/div[@class=\"pager\"]/*[last()][self::a and @class=\"navi\"]", | |
| "wedata.net.id":1670 | |
| }, | |
| { | |
| "url":"^http://postcode\\.goo\\.ne\\.jp/search", | |
| "pageElement":"//dl[@class='result mb10 cx']/*", | |
| "nextLink":"//li[@class='next ']/a", | |
| "wedata.net.id":64684 | |
| }, | |
| { | |
| "url":"^https?://(www\\.)?steamcompanion\\.com", | |
| "pageElement":"//a[contains(@class, 'giveaway-')]|//tr[contains(@class, 'item_')]|//div[@class='giveaway-links']", | |
| "nextLink":"//a[.='Next']", | |
| "wedata.net.id":77529 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?logosauce\\.com/\\w+", | |
| "pageElement":"//div[contains(concat(\" \", normalize-space(@class), \" \"), \" content \")]", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":1255 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?tineye\\.com/search/", | |
| "pageElement":"//div[@class=\"row matches\"]/div[@class=\"col-sm-12\"]/div", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":30212 | |
| }, | |
| { | |
| "url":"^http://club\\.autohome\\.com\\.cn/bbs/", | |
| "pageElement":"id('maxwrap-reply')/*", | |
| "nextLink":"//a[@class='afpage']", | |
| "wedata.net.id":77071 | |
| }, | |
| { | |
| "url":"^http://land\\.to/ranking/ranking\\.php", | |
| "pageElement":"id(\"ranking\")/div[contains(concat(\" \", @class, \" \"), \" rankingBox \")]", | |
| "nextLink":"//p[contains(concat(\" \", @class, \" \"), \" next \")]/a", | |
| "wedata.net.id":41408 | |
| }, | |
| { | |
| "url":"^http://sciencechannel\\.jst\\.go\\.jp/", | |
| "pageElement":"//ul[@class='ftBox'][./*]", | |
| "nextLink":"//article[@class=\"post ftBox\"][last()]//a[last()][not(@class=\"current\")]", | |
| "wedata.net.id":64889 | |
| }, | |
| { | |
| "url":"^http://www\\.asahi\\.com/job/syuukatu/", | |
| "pageElement":"//div[@class=\"BodyTxt\"]", | |
| "nextLink":"//p[@class=\"Next\"]/a", | |
| "wedata.net.id":57794 | |
| }, | |
| { | |
| "url":"^http://neetsha\\.jp/inside/comic\\.php", | |
| "pageElement":"id('main')/*[@class='image' or self::h1 or @class='text']", | |
| "nextLink":"id('main')//a[img]|//div[@class='center']/div/a[contains(.,'次')]", | |
| "wedata.net.id":61110 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?globe\\.asahi\\.com/", | |
| "pageElement":"id(\"unitBlockContents\")[not(id(\"contentsPaging\"))]/*|id(\"contentsPaging\")/preceding-sibling::*", | |
| "nextLink":"//p[@class=\"next\" or @class=\"pagingNext\"]/a", | |
| "wedata.net.id":26605 | |
| }, | |
| { | |
| "url":"^http://www\\.dennobaio\\.jp/shopbrand/", | |
| "pageElement":"id('goods_list')//tr", | |
| "nextLink":"id('page_sel')//a[.='[次]']", | |
| "wedata.net.id":57823 | |
| }, | |
| { | |
| "url":"^http://mixi\\.jp/new_friend_diary\\.pl", | |
| "pageElement":"id(\"bodyMainAreaMain\")/div/ul[@class=\"entryList01\"]", | |
| "nextLink":"id(\"bodyMainAreaMain\")/div/div[contains(@class,\"pageNavigation01\")]/div[contains(@class,\"pageList02\")]/ul/li[@rel=\"__next\"]/a", | |
| "wedata.net.id":45565 | |
| }, | |
| { | |
| "url":"^http://[^.]+\\.puny\\.jp/uploader\\d?/", | |
| "pageElement":"//table[@class='table table-striped table-bordered']//tr[td]", | |
| "nextLink":"//li[@class='active']/following-sibling::li[1]/a", | |
| "wedata.net.id":29391 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?ebten\\.jp/eb-store/", | |
| "pageElement":"//ul[@class='fixHeight']/li", | |
| "nextLink":"//a[@title='次へ']", | |
| "wedata.net.id":872 | |
| }, | |
| { | |
| "url":"^http://vocaloid\\.blog120\\.fc2\\.com/", | |
| "pageElement":"id(\"left\")/*[self::div or self::h3]", | |
| "nextLink":"id(\"left\")/a[contains(., \"\u6b21\u306e\")]", | |
| "wedata.net.id":26698 | |
| }, | |
| { | |
| "url":"^http://www\\.(?:manga|perv)eden\\.com/", | |
| "pageElement":"id(\"nextA\")", | |
| "nextLink":"//div[contains(concat(\" \",normalize-space(@class),\" \"), \" pagination \")]//a[contains(@class,\"next\")]", | |
| "wedata.net.id":60836 | |
| }, | |
| { | |
| "url":"^http://gendai\\.ismedia\\.jp/articles/", | |
| "pageElement":"//div[@class=\"articleContents\"]/*", | |
| "nextLink":"//a[./li[@class=\"next\"]]", | |
| "wedata.net.id":77449 | |
| }, | |
| { | |
| "url":"^http://b\\.hatena\\.ne\\.jp/[^/]/video", | |
| "pageElement":"//ul[@class='entry-vertical-4']|//div[@class='box3_2 notitle']", | |
| "nextLink":"//a[@class='pager-next']", | |
| "wedata.net.id":29268 | |
| }, | |
| { | |
| "url":"^http://seiji\\.yahoo\\.co\\.jp/article", | |
| "pageElement":"//ul[@class='feedList']/li", | |
| "nextLink":"//div[@class='feedBtn nextBtn']/a", | |
| "wedata.net.id":29240 | |
| }, | |
| { | |
| "url":"http://karen.saiin.net/~mitosupa/or02B/", | |
| "pageElement":"//a[img]", | |
| "nextLink":"//a[img]", | |
| "wedata.net.id":74451 | |
| }, | |
| { | |
| "url":"^https://(?:www\\.)?graffletopia\\.com/", | |
| "pageElement":"//div[@id='content']/div[@class='stencil well']", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":29136 | |
| }, | |
| { | |
| "url":"^http://nohira\\.web\\.fc2\\.com/comic/", | |
| "pageElement":"//div[contains(concat(\" \", @class, \" \"), \" main \") and not(ancestor::div[contains(concat(\" \", @class, \" \"), \" main \")])]", | |
| "nextLink":"//div[contains(concat(\" \", @class, \" \"), \" navi \")]/descendant::a[contains(@href, \"index.html\")]/following-sibling::a[1]", | |
| "wedata.net.id":55204 | |
| }, | |
| { | |
| "url":"^http://www\\.toranoana\\.jp/mailorder/", | |
| "pageElement":"//table[@class=(\"table_simple_outerflame\" or \"table_common_main_innerflame\" or \"table_common_main_innerflame_blue\") and @summary=\"data\"]|//table[@class=(\"table_simple_outerflame\" or \"table_common_main_innerflame\" or \"table_common_main_innerflame_blue\")]/following-sibling::table[@summary=\"Details\"]|//table[@class=(\"table_simple_outerflame\" or \"table_common_main_innerflame\" or \"table_common_main_innerflame_blue\")]/following-sibling::br[preceding-sibling::table[@summary=\"Details\"] and following-sibling::table[@summary=\"Details\"]]", | |
| "nextLink":"//a[text()=\">\"]", | |
| "wedata.net.id":696 | |
| }, | |
| { | |
| "url":"^https?://(forum|www)\\.mql(4|5)\\.com/", | |
| "pageElement":"//div[@class='tablekul']//tr[td]|//table[@class='commentlist']|//div[@class='topBlock bordered' or @class='topBlock block']", | |
| "nextLink":"//a[@class='selected'][//link[@rel='canonical'][contains(@href,'https://forum.mql4.com')]]/following-sibling::a[1]|//div[@class='body']//span/strong[number()>0]/following-sibling::a[1]|//a[@rel='next']", | |
| "wedata.net.id":55165 | |
| }, | |
| { | |
| "url":"^http://pornograd\\.net/viewforum\\.php", | |
| "pageElement":"//table[@id='forum-table']/tbody/tr[@id]", | |
| "nextLink":"//a[@class=\"menu-root\"]/following-sibling::b/following-sibling::a[1]", | |
| "wedata.net.id":80875 | |
| }, | |
| { | |
| "url":"^http://dl\\.acm\\.org/results\\.cfm\\?", | |
| "pageElement":"id(\"resultmenu\")/following-sibling::*[following-sibling::div[@class=\"pagerange\"]]", | |
| "nextLink":"//div[@class=\"pagelogic\"]/span[./strong]/following-sibling::span[./a][1]/a", | |
| "wedata.net.id":409 | |
| }, | |
| { | |
| "url":"^http://www\\.dmm\\.co(?:m|\\.jp)/mono/", | |
| "pageElement":"id('list')/li", | |
| "nextLink":"//link[@rel='next']", | |
| "wedata.net.id":52921 | |
| }, | |
| { | |
| "url":"^http://irohairo\\.blog108\\.fc2\\.com/", | |
| "pageElement":"id('main')/*[not(self::div and @class='page_navi' or @class='content2')]", | |
| "nextLink":"//div[@class='page_navi']/a[@title='次のページ']", | |
| "wedata.net.id":27629 | |
| }, | |
| { | |
| "url":"^http://blog\\.goo\\.ne\\.jp/herbsaison", | |
| "pageElement":"//div[@class='mod-entry-set']", | |
| "nextLink":"//a[span='前ページ']", | |
| "wedata.net.id":27618 | |
| }, | |
| { | |
| "url":"^http://www\\.realmadrid\\.com/.+/news/", | |
| "pageElement":"//div[@class='news_results_row']/ul/li", | |
| "nextLink":"//a[@class='m_paginator_next']", | |
| "wedata.net.id":52969 | |
| }, | |
| { | |
| "url":"^http://akirasugano\\.blog\\.fc2\\.com/", | |
| "pageElement":"id(\"left\")/*[self::h3 or self::div[@class=\"body\"]]", | |
| "nextLink":"//a[contains(text(), \"次のページ\")]", | |
| "wedata.net.id":63329 | |
| }, | |
| { | |
| "url":"^http://www\\.popsci\\.com(?:/[^/]+){4}", | |
| "pageElement":"id(\"container\")/div[@class=\"content\"]//div[@class=\"pager\"]/preceding-sibling::*[not(@class=\"dek\" or @class=\"submitted\")]", | |
| "nextLink":"id(\"container\")/div[@class=\"content\"]//span[@class=\"pagination\"]/a[contains(., \"next\")]", | |
| "wedata.net.id":27503 | |
| }, | |
| { | |
| "url":"^http://kakaku\\.com/.+/itemlist\\.aspx", | |
| "pageElement":"id('compTblList')/tbody/tr[@class='tr-border'][td]", | |
| "nextLink":"//div[@class='pagenation']//li[@class='now']/following-sibling::*[1][self::li]/a", | |
| "wedata.net.id":2767 | |
| }, | |
| { | |
| "url":"^http://www\\.ntticc\\.or\\.jp/Archive", | |
| "pageElement":"//ul[@class=\"headline2_s\"]/preceding-sibling::*[self::p or @class=\"headline\"]", | |
| "nextLink":"//span[@class='tonext']/a", | |
| "wedata.net.id":27530 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?producingoss\\.com/", | |
| "pageElement":"//div[@class='navheader']/../div[not(starts-with(@class,'nav'))]", | |
| "nextLink":"//div[@class='navheader']//a[@accesskey='n']", | |
| "wedata.net.id":27357 | |
| }, | |
| { | |
| "url":"^https?://employment\\.en-japan\\.com/", | |
| "pageElement":"//div[@class='jobSearchListUnit']", | |
| "nextLink":"//li[@class='nextBtn']/a", | |
| "wedata.net.id":27541 | |
| }, | |
| { | |
| "url":"^http://appteam\\.blog114\\.fc2\\.com/", | |
| "pageElement":"id(\"left\")/div[@class=\"kizinav\"]/preceding-sibling::*", | |
| "nextLink":"id(\"left\")/div[@class=\"shitanabi\"]/div[@class=\"old\"]/a", | |
| "wedata.net.id":27271 | |
| }, | |
| { | |
| "url":"^http://drawr\\.net/fav(ing|ter)\\.php", | |
| "pageElement":"id(\"content\")", | |
| "nextLink":"//div[@class=\"floright\"]/a[starts-with(text(), \"Next\")]", | |
| "wedata.net.id":27654 | |
| }, | |
| { | |
| "url":"^https://answers\\.unrealengine\\.com/", | |
| "pageElement":"//div[not(@style)]/div[@class=\"short-summary\"][@data-id]", | |
| "nextLink":"//a[@title='next']", | |
| "wedata.net.id":77273 | |
| }, | |
| { | |
| "url":"^https?://joshinweb\\.jp/srh\\.html\\?", | |
| "pageElement":"//table[@width='100%'][@cellspacing='0'][@cellpadding='0'][@border='0'][@bgcolor='white']/tbody/tr[td/@align='center' or td/table][following-sibling::tr[last()]]", | |
| "nextLink":"//a[font=' -> ']", | |
| "wedata.net.id":28891 | |
| }, | |
| { | |
| "url":"^http://kenplatz\\.nikkeibp\\.co\\.jp/", | |
| "pageElement":"//ul[@class='list-type1']/li|id('articleBody')/*", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":27133 | |
| }, | |
| { | |
| "url":"^https://medical-knowledge\\.net/user/", | |
| "pageElement":"id('seal-all-list')|//div[@class='box-lecture-list']", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":77430 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?llamarepublik\\.com", | |
| "pageElement":"//*[@id=\"g-photo\" or @id=\"g-album-grid\"]", | |
| "nextLink":"//li[@class=\"g-text-right\"]/a", | |
| "wedata.net.id":77220 | |
| }, | |
| { | |
| "url":"^https://www\\.twingly\\.com/search\\?", | |
| "pageElement":"//div[@class='commentContainer']", | |
| "nextLink":"//a[.='次の10件']", | |
| "wedata.net.id":26731 | |
| }, | |
| { | |
| "url":"^http://www\\.photozone\\.de/[^/]+/\\d", | |
| "pageElement":"//div[@class='pagenavcounter']/following-sibling::node()[following-sibling::div/@class='pagenavbar']", | |
| "nextLink":"//a[@class='pageButton'][contains(.,'NEXT PAGE')]", | |
| "wedata.net.id":26728 | |
| }, | |
| { | |
| "url":"^http://([^.]+\\.)?advenbbs\\.net/bbs/", | |
| "pageElement":"//b[@class='n']/ancestor::p[1]/preceding-sibling::*", | |
| "nextLink":"//b[@class='n']/following-sibling::a[@class='n'][1]", | |
| "wedata.net.id":29275 | |
| }, | |
| { | |
| "url":"^http://www\\.iconspedia\\.com/search/", | |
| "pageElement":"//div[@class='icon_show']/ul/li[not(@class='ad_space')]", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":29290 | |
| }, | |
| { | |
| "url":"^http://www\\.kinopoisk\\.ru/.+?\\d+.*", | |
| "pageElement":"//div[@class='profileFilmsList']/div[starts-with(@class,'item')]|//table[@class='fotos']/tbody/tr|//div[@class='reviewItem userReview']", | |
| "nextLink":"//*[@class='navigator']//*[span]//following-sibling::*[1]//a", | |
| "wedata.net.id":77177 | |
| }, | |
| { | |
| "url":"^http://www.(theycam|girlsdocam).com.+", | |
| "pageElement":"//div[@class=\"items\"]/ul/li", | |
| "nextLink":"//a[contains(text(), \"next page >\")]", | |
| "wedata.net.id":77463 | |
| }, | |
| { | |
| "url":"^https?://(?:gm?\\.e-|ex)hentai\\.org/", | |
| "pageElement":"//*[(self::table or self::div) and contains(concat(\" \", @class, \" \"), \" itg \")]|//div[contains(concat(\" \", @class, \" \"), \" sni \")]/div/a[./*[self::img and last()=1]]|id(\"gdt\")/*", | |
| "nextLink":"//td[contains(concat(\" \", @class, \" \"), \" ptds \")]/following-sibling::td[1]/a[not(@href=\"#\")]|//div[contains(concat(\" \", @class, \" \"), \" sni \")]/div/a[./*[self::img and last()=1]]", | |
| "wedata.net.id":26665 | |
| }, | |
| { | |
| "url":"^http://www\\.date2\\.jp/package_list/", | |
| "pageElement":"//div[@class='list']/ul/li", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":29446 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?newsweekjapan\\.jp/", | |
| "pageElement":"id(\"content\")//*[contains(concat(\" \", @class, \" \"), \" entryPagenate \")]/preceding-sibling::*", | |
| "nextLink":"//ul[@class=\"indexNavi clearfix\"]/li[@class=\"next\"]/a", | |
| "wedata.net.id":29478 | |
| }, | |
| { | |
| "url":"^http://eq2bell\\.blog113\\.fc2\\.com/", | |
| "pageElement":"//div[@class='content'][div/@class='entry_body'][position()>1]", | |
| "nextLink":"//link[@rel='next']", | |
| "wedata.net.id":26601 | |
| }, | |
| { | |
| "url":"^http://www\\.e-tomcat\\.com/products/", | |
| "pageElement":"//div[@class='tc_goods_list']", | |
| "nextLink":"//div[@class=\"navi\"]/strong/following-sibling::a[1]", | |
| "wedata.net.id":26593 | |
| }, | |
| { | |
| "url":"^http://[^.]+\\.oricon\\.co\\.jp/news/", | |
| "pageElement":"id('main_photo')|//div[@class='photo_caption photo_news']|//div[@class='block-card-list']/article", | |
| "nextLink":"//a[i/@class='right' or @class='pager-next']", | |
| "wedata.net.id":26484 | |
| }, | |
| { | |
| "url":"^http://withnews\\.jp/(articles?|dig)/", | |
| "pageElement":"id('content')/section[contains(concat(' ',@class,' '),' articleBox ')]/article/*[following-sibling::div/@class='PagenationArea']//div[@class='recommend_article genre_article clearfix']/dl|//ul[@class='digCList']/li", | |
| "nextLink":"//*[@class='NextTitle' or @class='next']/a", | |
| "wedata.net.id":77510 | |
| }, | |
| { | |
| "url":"^http://www\\.insightnow\\.jp/article/", | |
| "pageElement":"//div[@class=\"section\"]", | |
| "nextLink":"//div[@class=\"next\"]/a", | |
| "wedata.net.id":29575 | |
| }, | |
| { | |
| "url":"^http://robot\\.tsukumo\\.co\\.jp/dir/", | |
| "pageElement":"//table[@class='productIndexDetail']/tbody/tr[td]", | |
| "nextLink":"//td[@class='next']/a", | |
| "wedata.net.id":26221 | |
| }, | |
| { | |
| "url":"^http://www\\.zaikaisapporo\\.co\\.jp/", | |
| "pageElement":"//div[@class=\"socialWrap\"]/following-sibling::*", | |
| "nextLink":"//div[@class=\"box menu\"]//p[./a[contains(text(),//span[@class=\"mincho\"]/text())]]/following-sibling::p[1]/a", | |
| "wedata.net.id":61296 | |
| }, | |
| { | |
| "url":"^http://videotopics\\.yahoo\\.co\\.jp/", | |
| "pageElement":"//div[contains(@class,'sr-con-inn')]/ul/li", | |
| "nextLink":"//strong[@class='yschnxtb']/a", | |
| "wedata.net.id":26002 | |
| }, | |
| { | |
| "url":"^http://search\\.mext\\.go\\.jp/search", | |
| "pageElement":"id('resultstop')/li", | |
| "nextLink":"//div[@class='pager']/ul/li[text()]/following-sibling::li[1]/a", | |
| "wedata.net.id":30217 | |
| }, | |
| { | |
| "url":"^http://s\\.luna\\.tv/search\\.aspx\\?", | |
| "pageElement":"//div[@class='search']", | |
| "nextLink":"//li[span/@class='select_box']/following-sibling::li/a[1]", | |
| "wedata.net.id":30218 | |
| }, | |
| { | |
| "url":"^http://www\\.potravinynapranyri\\.cz/", | |
| "pageElement":"//div[@class='f-item']", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":64896 | |
| }, | |
| { | |
| "url":"^http://forums\\.digitalspy\\.co\\.uk/", | |
| "pageElement":"//tr[@class='forumrow']|id('posts')/div", | |
| "nextLink":"//div[@class='pagenav']//td[not(@class)][last()]/a", | |
| "wedata.net.id":77032 | |
| }, | |
| { | |
| "url":"^https://www\\.transifex\\.com/connect", | |
| "pageElement":"id('projects-main')/*[div]", | |
| "nextLink":"//li[span/@class='is-current']/following-sibling::li/a", | |
| "wedata.net.id":77030 | |
| }, | |
| { | |
| "url":"^http://www\\.mangablack\\.com/manga/*", | |
| "pageElement":"//img[@class=\"img-responsive\"]/parent::a", | |
| "nextLink":"//img[@class=\"img-responsive\"]/parent::a", | |
| "wedata.net.id":77544 | |
| }, | |
| { | |
| "url":"^http://bugguide\\.net/node/view/\\d+/", | |
| "pageElement":"//td[@class='node-main-alt']/a", | |
| "nextLink":"//a[img/@alt=\"next page\"]", | |
| "wedata.net.id":30297 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?gamesetwatch\\.com/", | |
| "pageElement":"//div[@class='post']", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":30666 | |
| }, | |
| { | |
| "url":"^http://www\\.kumikomi\\.net/archives/", | |
| "pageElement":"//div[@class='body']/*", | |
| "nextLink":"//a[@title='次のページへ']", | |
| "wedata.net.id":30717 | |
| }, | |
| { | |
| "url":"^http://www\\.poverty\\.jeez\\.jp/ura/", | |
| "pageElement":"//table[@summary=\"files\"]//tr", | |
| "nextLink":"//p[@class=\"tline\"]/strong/following-sibling::a[1]", | |
| "wedata.net.id":57170 | |
| }, | |
| { | |
| "url":"^http://www\\.bitme\\.org/browse\\.php", | |
| "pageElement":"//table[@class=\"main\"]/tbody/tr/td[2]/table[2]/tbodyrn", | |
| "nextLink":"//a[descendant::*[contains(text(),\"Next\")]]", | |
| "wedata.net.id":30778 | |
| }, | |
| { | |
| "url":"^http://www\\.expertreviews\\.co\\.uk/", | |
| "pageElement":"id('block-system-main')//ul[@class='view-rows']/li|//section[@class='pagination mn_background']/following-sibling::*[not(@id='node-review-full-group-specs' or @id='share-top-wrapper')][following-sibling::section/@class='pagination mn_expanded']", | |
| "nextLink":"//a[@title='Go to next page']|//span[@class='mn_next']/a", | |
| "wedata.net.id":76971 | |
| }, | |
| { | |
| "url":"^https://www\\.drbd\\.jp/users-guide/.", | |
| "pageElement":"//div[@class='navheader']/following-sibling::div[1]", | |
| "nextLink":"//a[@accesskey='n']", | |
| "wedata.net.id":30807 | |
| }, | |
| { | |
| "url":"^http://www\\.slideshare\\.net/search/", | |
| "pageElement":"//ul[starts-with(@class,'ss-thumbnail')]", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":76957 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?hentai4manga\\.com/", | |
| "pageElement":"id(\"textboxContent\")/a[img]|id(\"thumblist\")|id(\"innerContent\")/div[@class=\"textbox\" and child::div[@class=\"textbox-content\"]]", | |
| "nextLink":"//div[@class=\"pages\"]/span[@class=\"pagelink-current\"]/following-sibling::a |//a[contains(text(), \"Next\")]", | |
| "wedata.net.id":65167 | |
| }, | |
| { | |
| "url":"^http://www\\.entertainmentwise\\.com/", | |
| "pageElement":"//article", | |
| "nextLink":"//nav[@class='vce-load-more']/a", | |
| "wedata.net.id":76923 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?stuffonmycat\\.com/", | |
| "pageElement":"//div[@class='arthumb']", | |
| "nextLink":"//li[@class='active_page']/following-sibling::li[1]/a", | |
| "wedata.net.id":31031 | |
| }, | |
| { | |
| "url":"^http://earthobservatory\\.nasa\\.gov/", | |
| "pageElement":"//div[@class='grid-mid']/div|//div[@class='features-list-sml']/div[starts-with(@class,'feature-item')]", | |
| "nextLink":"//span[@class='pagi-l']/a", | |
| "wedata.net.id":31178 | |
| }, | |
| { | |
| "url":"^http://labslog\\.scaltinof\\.net/memo", | |
| "pageElement":"//div[@class='announcement']", | |
| "nextLink":"id('sites-pagination-next-link-top')", | |
| "wedata.net.id":31615 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?legitreviews\\.com/", | |
| "pageElement":"//div[@class='main-content-article-div']/*[following-sibling::div/@class='forum-link']", | |
| "nextLink":"//a[contains(span,'Next »')]", | |
| "wedata.net.id":32046 | |
| }, | |
| { | |
| "url":"^http://[^./]+\\.seesaa\\.net/article/", | |
| "pageElement":"id(\"content\")/div[contains(concat(\" \", @class, \" \"), \" blog \") or @id=\"trackback\" or @id=\"comments\"]", | |
| "nextLink":"id(\"content\")/div[@class=\"navi\"]//a[contains(text(), \"<<\")]", | |
| "wedata.net.id":32287 | |
| }, | |
| { | |
| "url":"^https://(?:blogs|search)\\.sun\\.com/", | |
| "pageElement":"//div[@class='entry']", | |
| "nextLink":"//div[@class='blockheadwrap']//a[contains(., '»')]", | |
| "wedata.net.id":32393 | |
| }, | |
| { | |
| "url":"^http://kossie\\.net/blog/[^/]+/[^/]+/", | |
| "pageElement":"//div[contains(concat(' ',@class,' '),' entry-asset ')]", | |
| "nextLink":"//div[@class=\"content-nav\"]/a[starts-with(text(),\"\u00ab\")]", | |
| "wedata.net.id":2745 | |
| }, | |
| { | |
| "url":"^http://drawr\\.net/(new|thread)\\.php", | |
| "pageElement":"//div[@class='drawr_box']|//table[@class='threadTransBlock']//tr", | |
| "nextLink":"//p[@class='left-food-link']/a[contains(.,'Older')]", | |
| "wedata.net.id":2713 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?iht\\.com/articles/", | |
| "pageElement":"id(\"article_box\")/p", | |
| "nextLink":"id(\"pagination\")/a[text()=\"Next Page\"]", | |
| "wedata.net.id":2674 | |
| }, | |
| { | |
| "url":"^http://blog\\.practical-scheme\\.net/", | |
| "pageElement":"//div[@class='n-entry-show']", | |
| "nextLink":"//a[.='More entries ...']", | |
| "wedata.net.id":32404 | |
| }, | |
| { | |
| "url":"^http://(?:\\w+\\.)?dlouha-videa\\.cz/", | |
| "pageElement":"id(\"archive\")//div[contains(concat(\" \", @class, \" \"), \" entry \")]", | |
| "nextLink":"id('archive')//div[contains(concat(\" \", @class, \" \"), \" wp-pagenavi \")]/descendant::span[contains(concat(\" \", @class, \" \"), \" current \")]/following-sibling::a[1]", | |
| "wedata.net.id":55931 | |
| }, | |
| { | |
| "url":"^http://t21\\.nikkei\\.co\\.jp/g3/p03/", | |
| "pageElement":"//table[@class='HeadlineList']/tbody/tr[td]", | |
| "nextLink":"//a[contains(.,'次へ')]", | |
| "wedata.net.id":76493 | |
| }, | |
| { | |
| "url":"^http://techon\\.nikkeibp\\.co\\.jp/.+", | |
| "pageElement":"//section[@class='bn-section']|id('kiji')/* | //div[@class='article-body']/*[not(@class='pager')]| //div[@id=\"article\"]", | |
| "nextLink":"//*[@class='next']/a | //link[@rel='next']| //a[(text()=\"次のページ >\")]| //a[(text()=\"次のページ ≫\")]", | |
| "wedata.net.id":77683 | |
| }, | |
| { | |
| "url":"^http://www\\.julian-pb\\.com/library/", | |
| "pageElement":"//div[@class='thumbnaillist']/*", | |
| "nextLink":"//a[@class='next page-numbers']", | |
| "wedata.net.id":65446 | |
| }, | |
| { | |
| "url":"^http://www\\.fastcompany\\.com/search", | |
| "pageElement":"//article", | |
| "nextLink":"//li[@class='search-result-next hide-for-small']/a", | |
| "wedata.net.id":32722 | |
| }, | |
| { | |
| "url":"^https://community\\.secondlife\\.com/", | |
| "pageElement":"//div[contains(@id,'messageview')]", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":2358 | |
| }, | |
| { | |
| "url":"^http://www\\.superbreak\\.com/search/", | |
| "insertBefore":"id(\"botPaging\")", | |
| "pageElement":"id(\"hotelList\")", | |
| "nextLink":"id(\"botPaging\")/ul[@class=\"pagination\"]/li[@class=\"rArrow\"]/a", | |
| "wedata.net.id":32757 | |
| }, | |
| { | |
| "url":"^http://[^.]+\\.blog[^.]*\\.fc2\\.com/", | |
| "pageElement":"id('left')/a/preceding-sibling::*", | |
| "nextLink":"id('left')/a", | |
| "wedata.net.id":55777 | |
| }, | |
| { | |
| "url":"^http://mantan-web\\.jp/gallery/\\d{4}", | |
| "pageElement":"//article/figure", | |
| "nextLink":"//article//a[@class=\"next\"]", | |
| "wedata.net.id":55775 | |
| }, | |
| { | |
| "url":"^http://beatarai\\.blog90\\.fc2\\.com/", | |
| "pageElement":"id('mainBlock')/div[.//@class='editentry']", | |
| "nextLink":"id(\"siteinfo-legal\")/a[last()][not(@href=\"http://beatarai.blog90.fc2.com/\")]", | |
| "wedata.net.id":76326 | |
| }, | |
| { | |
| "url":"http://woodbook\\.xyz/([?]paged=\\d+)?", | |
| "pageElement":"id('topnews')/*", | |
| "nextLink":"//span[@class='current']/following-sibling::*[1]", | |
| "wedata.net.id":76325 | |
| }, | |
| { | |
| "url":"^http://www\\.bunicomic\\.com/comic/.+", | |
| "pageElement":"//div[@class='comic-table']", | |
| "nextLink":"id('comic-nav-wrapper')//a[starts-with(.,'Next')]", | |
| "wedata.net.id":77783 | |
| }, | |
| { | |
| "url":"^http://(www|2014)\\.yurugp\\.jp/vote/", | |
| "pageElement":"//ul[@class='thumbnailList']/li", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":76285 | |
| }, | |
| { | |
| "url":"^http://book\\.zongheng\\.com/chapter/", | |
| "pageElement":"id('chapterContent')", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":33271 | |
| }, | |
| { | |
| "url":"^http://[^./]+\\.nationalreview\\.com/", | |
| "pageElement":"//div[@class='story-container']", | |
| "nextLink":"//div[@class='next']/a", | |
| "wedata.net.id":33783 | |
| }, | |
| { | |
| "url":"^https://github\\.com/.+?/repositories", | |
| "pageElement":"//ul[@class='repo-list js-repo-list']/div", | |
| "nextLink":"//a[@class='next_page']", | |
| "wedata.net.id":75035 | |
| }, | |
| { | |
| "url":"^http://pururin\\.com/(?:view|browse)?", | |
| "pageElement":"//a[@class='image-next']|//ul[@class='gallery-list']/li", | |
| "nextLink":"//a[@class='image-next' or @class='link-next']", | |
| "wedata.net.id":75021 | |
| }, | |
| { | |
| "url":"^http://(community|medqua)\\.m3\\.com/", | |
| "pageElement":"id('m3_main-body')//div[@class='m3_separated']|//div[@class='m3_community-thread-contents']", | |
| "nextLink":"(id('m3_mr-message-list')//tr[@class='m3_come-bg-orange1'])[last()]/following-sibling::tr//a|//a[starts-with(.,'次へ')]", | |
| "wedata.net.id":65724 | |
| }, | |
| { | |
| "url":"^http://www\\.footballchannel\\.jp/\\d", | |
| "insertBefore":"//div[@class=\"nextpage\"]", | |
| "pageElement":"//div[@class=\"entry_body\"]/*[not(@class=\"nextpage\")]", | |
| "nextLink":"//p[@class=\"pager\"]/a[preceding-sibling::span][1]", | |
| "wedata.net.id":65807 | |
| }, | |
| { | |
| "url":"^http://(?:[^.]{6}\\.)?sa\\.yona\\.la/", | |
| "pageElement":"id('entries')/div[contains(@class,'entry')]", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":2018 | |
| }, | |
| { | |
| "url":"^http://[^.]+\\.teacup\\.com/[^.]+/bbs", | |
| "pageElement":"id(\"contents\")/div[@class=\"pagination\"][1]/following-sibling::node()[following::div[@class=\"pagination\"]]|//div[@class=\"col-lg-10 col-lg-offset-1\"]", | |
| "nextLink":"id(\"contents\")/div[@class=\"pagination\"]//a[last()]|//ul[@class=\"pagination\"]/li[last()]/a[not(@href=\"#\")]", | |
| "wedata.net.id":74974 | |
| }, | |
| { | |
| "url":"^http://www\\.jsgoal\\.jp/(news|photo)", | |
| "pageElement":"//section[@class='field']/ul/li|//div[@class='nextback clearfix']/preceding-sibling::*", | |
| "nextLink":"//a[i/@class='fa fa-chevron-right']", | |
| "wedata.net.id":1993 | |
| }, | |
| { | |
| "url":"^http://www\\.dmm\\.co\\.jp/dc/doujin/", | |
| "pageElement":"//div[@class=\"m-productList\"]/ul/li", | |
| "nextLink":"//link[@rel=\"next\"]", | |
| "wedata.net.id":79971 | |
| }, | |
| { | |
| "url":"^http://newsteam\\.blog95\\.fc2\\.com/", | |
| "pageElement":"id(\"main\")/div[contains(@class,\"entry\")]", | |
| "nextLink":"//li[contains(concat(\" \",@class,\" \"),\" older \")]/a", | |
| "wedata.net.id":1931 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?smooche\\.jp/rinka/", | |
| "pageElement":"id('main')/article", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":36468 | |
| }, | |
| { | |
| "url":"^http://b\\.hatena\\.ne\\.jp/entrylist", | |
| "pageElement":"//*[contains(concat(\" \", normalize-space(@class), \" \"), \" entrylist \")]", | |
| "nextLink":"//link[@rel=\"next\"]", | |
| "wedata.net.id":66071 | |
| }, | |
| { | |
| "url":"^http://ugigi\\.dvrdns\\.org/search\\?", | |
| "pageElement":"id(\"selectmlfilter\")/following-sibling::div[contains(concat(\" \", descendant-or-self::div/@class, \" \"), \" sakuhin \")]", | |
| "nextLink":"id(\"kokoko\")/span/a[text()=\"\u6b21\u3078\"]", | |
| "wedata.net.id":37600 | |
| }, | |
| { | |
| "url":"^http://kanasoku\\.blog82\\.fc2\\.com/", | |
| "pageElement":"//div[@class='entry_body' or @class='ent_top']", | |
| "nextLink":"//a[.='次のページ']", | |
| "wedata.net.id":1927 | |
| }, | |
| { | |
| "url":"http://www.lastfm.jp/home/friendsloved", | |
| "pageElement":"//ul[@id=\"friendsLoved\"]", | |
| "nextLink":"//div[@class=\"pagination\"]/a[@class=\"nextlink\"]", | |
| "wedata.net.id":72701 | |
| }, | |
| { | |
| "url":"^https://www\\.youtube\\.com/results.+", | |
| "pageElement":"//ol[@class=\"item-section\"]/li[.//img]", | |
| "nextLink":"//div[contains(@class,\"search-pager\")]/button/following-sibling::a[1]", | |
| "wedata.net.id":1856 | |
| }, | |
| { | |
| "url":"^https?://github\\.com/[^/]+/following", | |
| "pageElement":"//li[@class='follow-list-item']", | |
| "nextLink":"//div[@class=\"pagination\"][count(./a)>1 or ./span[@class=\"disabled\"]/following-sibling::a]/a[last()]", | |
| "wedata.net.id":38627 | |
| }, | |
| { | |
| "url":"^http://pastie\\.org/(?:pastes|search)", | |
| "pageElement":"//div[@class='pastePreview']", | |
| "nextLink":"//a[.='Next page']|//div[@class='months']/div[2]/a[@class='selected']/preceding-sibling::a[1][not(//a='Next page')]|//div[@class='months']/div[1]/a[@class='selected']/preceding-sibling::a[1][not(//a='Next page')][not(//div[@class='months']/div[2]/a[@class='selected']/preceding-sibling::a[1])]", | |
| "wedata.net.id":1845 | |
| }, | |
| { | |
| "url":"^https?://www\\.bing\\.com/news/search", | |
| "pageElement":"//div[@class=\"sn_r\"]", | |
| "nextLink":"//a[@class=\"sb_pagN\"]", | |
| "wedata.net.id":74891 | |
| }, | |
| { | |
| "url":"^http://7toriaezu\\.blog\\.fc2\\.com/*", | |
| "pageElement":"id('center')/div[@class='ently_outline']", | |
| "nextLink":"//a[@title='次のページへ進む']", | |
| "wedata.net.id":63108 | |
| }, | |
| { | |
| "url":"^http://chiquita\\.blog17\\.fc2\\.com/", | |
| "pageElement":"id(\"main_block\")/div[@class=\"entry_block\"]", | |
| "nextLink":"//div[@class=\"pnavi\"]/a[text()=\"NEXT\"]", | |
| "wedata.net.id":1822 | |
| }, | |
| { | |
| "url":"^http://m\\.hkgolden\\.com/view\\.aspx", | |
| "insertBefore":"id(\"bottomFunc\")", | |
| "pageElement":"id(\"bottomFunc\")/preceding-sibling::*[(self::div[@class=\"ReplyBox\"] or self::div[@class=\"ReplyFunc\"]) and ./*]", | |
| "nextLink":"//a[contains(text(),\"\u4e0b\u4e00\u9801\")]", | |
| "wedata.net.id":38850 | |
| }, | |
| { | |
| "url":"^https://sublime\\.wbond\\.net/browse/", | |
| "pageElement":"//ul[@class='packages results']", | |
| "nextLink":"//a[@class='selected']/following-sibling::a[1]", | |
| "wedata.net.id":74833 | |
| }, | |
| { | |
| "url":"^http://omoroid\\.blog103\\.fc2\\.com/", | |
| "pageElement":"//div[@class=\"primary-column\"]/div[contains(@class, \"section\")]", | |
| "nextLink":"//li[@class=\"next\"]/a", | |
| "wedata.net.id":1801 | |
| }, | |
| { | |
| "url":"^http://www\\.cecile\\.co\\.jp/genre/.", | |
| "pageElement":"//div[@class='itemlist']", | |
| "nextLink":"id('se_pagingNext')", | |
| "wedata.net.id":39637 | |
| }, | |
| { | |
| "url":"^http://www\\.sportsworldreport\\.com/", | |
| "pageElement":"id('contents-in')/div/div/div[@class='list' or @class='headbox']", | |
| "nextLink":"//span[@class=\"no current\"]/following-sibling::a[1]", | |
| "wedata.net.id":74734 | |
| }, | |
| { | |
| "url":"^http://www\\.hollywoodreporter\\.com/", | |
| "pageElement":"//div[@class='blog-entries']/article|//div[@class='search-results']/dl/div|//div[@class='module thr-latest-news']/ol/li", | |
| "nextLink":"//a[@rel='next' or ..[starts-with(@class,'paginates forward') or @class='pager-next']]", | |
| "wedata.net.id":74720 | |
| }, | |
| { | |
| "url":"^http://voice\\.ivory\\.ne\\.jp/comic/", | |
| "pageElement":"//center", | |
| "nextLink":"//center/a[descendant::img]", | |
| "wedata.net.id":40761 | |
| }, | |
| { | |
| "url":"^http://dic\\.nicovideo\\.jp/b/[aiuv]/", | |
| "pageElement":"id(\"bbs\")/dl", | |
| "nextLink":"//span[@class=\"current\"]/following-sibling::a[1]", | |
| "wedata.net.id":1568 | |
| }, | |
| { | |
| "url":"^http://www\\.tamurayukari-diary\\.com", | |
| "pageElement":"//article[@class='diary-entry']", | |
| "nextLink":"//span[@class='pager_next']/a", | |
| "wedata.net.id":40779 | |
| }, | |
| { | |
| "url":"^http://kara\\.konjiki\\.jp/\\w+/\\w+/", | |
| "pageElement":"id(\"main wide\")/div/descendant-or-self::*[following-sibling::p[contains(concat(\" \", @class, \" \"), \" pagetop \")]]", | |
| "nextLink":"id(\"main wide\")//li[contains(concat(\" \", @class, \" \"), \" next \")][last()]/a", | |
| "wedata.net.id":40833 | |
| }, | |
| { | |
| "url":"^https?://[^\\.]+\\.livejournal\\.com/", | |
| "pageElement":"//*[(self::div or self::table or self::article) and (contains(concat(\" \",normalize-space(@class),\" \"), \" post \") or contains(concat(\" \",normalize-space(@class),\" \"), \" entrybox \") or contains(concat(\" \",normalize-space(@class),\" \"), \" entry \") or @class=\"j-e\" or contains(concat(\" \",normalize-space(@class),\" \"), \" entry-wrap \") or contains(concat(\" \",normalize-space(@class),\" \"), \" post-asset \"))]", | |
| "nextLink":"//a[contains(@href,\"?skip=\") and (contains(.,\"earlier\") or contains(.,\"back\") or contains(.,\"rev\") or contains(.,\"реды\") or contains(.,\"зад\") or contains(@class,\"rev\"))]", | |
| "wedata.net.id":40971 | |
| }, | |
| { | |
| "url":"^http://search\\.livedoor\\.com/search", | |
| "pageElement":"id('search-result')/ol/li", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":1042 | |
| }, | |
| { | |
| "url":"^http://(www\\.)?code-g\\.jp/bokoboko/", | |
| "pageElement":"id(\"col1\")/div[@class=\"article\"]/div[@class=\"article_top\" or @class=\"article_sentence\"]", | |
| "nextLink":"id(\"col1\")//p/a[contains(@href,concat(number(substring-after(substring-after(substring-before(//meta[@property=\"og:url\"]/@content,\".php\"),\"-\"),\"-\"))+1,\".php\"))]|id(\"col1\")//p/a[1][number(substring-after(substring-before(//meta[@property=\"og:url\"]/@content,\".php\"),\"bokoboko/\"))=1011204001]", | |
| "wedata.net.id":74653 | |
| }, | |
| { | |
| "url":"^https://(www\\.)?threadless\\.com/\\w", | |
| "pageElement":"id('catalog_products')/dd", | |
| "nextLink":"//a[.='Next']", | |
| "wedata.net.id":898 | |
| }, | |
| { | |
| "url":"^http://project-future\\.xepher\\.net/", | |
| "pageElement":"//tr[td/@class='tamid']", | |
| "nextLink":"//a[img/@src='images/pf_next.png']", | |
| "wedata.net.id":80806 | |
| }, | |
| { | |
| "url":"^http://scienceportal\\.jst\\.go\\.jp/", | |
| "pageElement":"//div[@class='sig lastParagraph']/preceding-sibling::*|//ul[@class='ul_basic01 columns']/li", | |
| "nextLink":"//div[@class='sig lastParagraph']/p/a[contains(.,'く')]|//a[@class='link_next']", | |
| "wedata.net.id":45630 | |
| }, | |
| { | |
| "url":"^http://drap\\.coremagazine\\.co\\.jp/", | |
| "pageElement":"//div[@class=\"postwrap\"]", | |
| "nextLink":"//link[@rel=\"prev\"] | //a[contains(text(), \"次のページ >\")]", | |
| "wedata.net.id":63642 | |
| }, | |
| { | |
| "url":"^https://(?:www\\.)?openclipart\\.org/", | |
| "pageElement":"//div[@class='r-img']", | |
| "nextLink":"//li[@class='active']/following-sibling::li[1]/a", | |
| "wedata.net.id":46582 | |
| }, | |
| { | |
| "url":"^http://s\\.hatena\\.ne\\.jp/.+?/stars", | |
| "insertBefore":"id(\"main\")/div[@class=\"pager\"]", | |
| "pageElement":"id(\"main\")/div[@class=\"list\"]", | |
| "nextLink":"id(\"main\")/div[@class=\"pager\"]/a[last()]", | |
| "wedata.net.id":706 | |
| }, | |
| { | |
| "url":"^https?://chan\\.sankakucomplex\\.com/", | |
| "pageElement":"id(\"post-list\")/div[@class=\"content\"]//span", | |
| "nextLink":"id(\"paginator\")//a[.=\">>\"]", | |
| "wedata.net.id":74337 | |
| }, | |
| { | |
| "url":"^http://movie\\.walkerplus\\.com/list/", | |
| "insertBefore":"//div[@class=\"pagingBox\"]", | |
| "pageElement":"//div[@class=\"onScreenBoxContentMovie\"]", | |
| "nextLink":"//li[@class=\"next\"]/a", | |
| "wedata.net.id":80834 | |
| }, | |
| { | |
| "url":"^http://[^.]+\\.blog[^.]+\\.fc2\\.com/", | |
| "pageElement":"id('main main-column center main_block Main primary-column blog content')[1]/div[(@class='main_block' and div/@class='main_title') or @class='content'] | id('contents Contents')[1]/div[not(@id)] | id('main')/table[starts-with(@class,'entry')] | id('blog_content')/div[@class] | id('right')/div[@class='contents'] | id('primary')/div[@class='entry'] | id('mainBlock')/div[div] | id('entry') | id('box_main')/table | id('left')/*[self::div/@class='body' or self::a[contains(.,'月')]] | //div[@align='center']/table[@width='740']//table[@width='660'] | id('topentry')/*[not(contains(@class,'navi'))] | //table[@id='layout']//td[@class='center']/table[.//h2/@class='entry_title'] | //article[@class='entry-m']", | |
| "nextLink":"descendant::a[contains(@href,\"fc2.com/page-\")][last()] | /descendant::a[contains(translate(text(), \"ENTX\", \"entx\"), \"next\")][last()]|//a[.='古いページへ']", | |
| "wedata.net.id":628 | |
| }, | |
| { | |
| "url":"^http://www\\.fsight\\.jp/subcategory/", | |
| "pageElement":"//div[@class='article-index-list']//li", | |
| "nextLink":"//div[@class='next']/a", | |
| "wedata.net.id":49091 | |
| }, | |
| { | |
| "url":"^http://blog\\.goo\\.ne\\.jp/kinokoweb", | |
| "insertBefore":"id(\"mod-prev-next\")", | |
| "pageElement":"id(\"in-center\")//div[@class=\"mod-entry-set\"]", | |
| "nextLink":"id(\"mod-prev-next\")//span[@class=\"etNextPrev\"]/parent::a", | |
| "wedata.net.id":497 | |
| }, | |
| { | |
| "url":"^http://wol\\.nikkeibp\\.co\\.jp/atcl/", | |
| "pageElement":"id(\"articleBody\")", | |
| "nextLink":"id(\"pages\")/ul/li[last()]/a", | |
| "wedata.net.id":80947 | |
| }, | |
| { | |
| "url":"^http://www\\.fate-go\\.jp/manga_fgo2/", | |
| "pageElement":"id(\"contents\")/div[@class=\"nest\"]/preceding-sibling::div", | |
| "nextLink":"//div[@class=\"pager_btn_area\"]/div[@class=\"prev_btn\"]/a", | |
| "wedata.net.id":80974 | |
| }, | |
| { | |
| "url":"https://(.+)\\.douban\\.com/doulist/.+", | |
| "pageElement":"//div[@class=\"doulist-item\"]", | |
| "nextLink":"//span[@class='next']/a", | |
| "wedata.net.id":80976 | |
| }, | |
| { | |
| "url":"^https?://(?:www\\.)?howtoforge\\.com/", | |
| "pageElement":"id('htfContentPage')/nav/preceding-sibling::*[not(self::h1)]", | |
| "nextLink":"id('articleNextLink')/a", | |
| "wedata.net.id":50269 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?alternativeto\\.net", | |
| "pageElement":"//ul[starts-with(@class,'app-list')]/li", | |
| "nextLink":"//li[@title='Next Page']/a", | |
| "wedata.net.id":73886 | |
| }, | |
| { | |
| "url":"^http://www\\.animate-onlineshop\\.jp/", | |
| "pageElement":"//ul[contains(concat(\" \", @class, \" \"), \" product_horizontal_list \")]", | |
| "nextLink":"//a[text()=\"次へ>>\"]", | |
| "wedata.net.id":53356 | |
| }, | |
| { | |
| "url":"^http://www\\.goal\\.com/jp/slideshow/", | |
| "pageElement":"//div[@class=\"article-slideshow-page\"]/*[not(@class=\"article-slideshow-pagination\")]", | |
| "nextLink":"//a[@class='button' and text()='Next']", | |
| "wedata.net.id":72735 | |
| }, | |
| { | |
| "url":"^http://seesaawiki\\.jp/w/yarurissi/d/", | |
| "pageElement":"//hr[@noshade=\"noshade\"][1]/following-sibling::*[following-sibling::span[@class=\"fsize\"]]|//hr[@noshade=\"noshade\"][1]/following-sibling::*[not(./self::span[@class=\"fsize\"])][following-sibling::a[@href=\"#top\"]]", | |
| "nextLink":"//div[@class=\"user-area\"]/span[@class=\"fsize\"]/a", | |
| "wedata.net.id":63404 | |
| }, | |
| { | |
| "url":"^http://rocketnews24\\\\.com/.*/.*/.*/", | |
| "pageElement":"//div[@class=\"entry-content\"]", | |
| "nextLink":"//a[text()=\"次へ ≫\"]", | |
| "wedata.net.id":72713 | |
| }, | |
| { | |
| "url":"^http://.*gsmarena\\.com\\/.*-review-", | |
| "pageElement":"//div[@id='review-body']", | |
| "nextLink":"//a[@class='pages-next']|//a[(text()='Next Page »')]", | |
| "wedata.net.id":80995 | |
| }, | |
| { | |
| "url":"^http://chokozai\\.kill\\.jp/comic2?/", | |
| "pageElement":"//a[img]", | |
| "nextLink":"//a[img]", | |
| "wedata.net.id":67221 | |
| }, | |
| { | |
| "url":"^http://[^./]+\\.howstuffworks\\.com/", | |
| "pageElement":"id('page0')", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":29091 | |
| }, | |
| { | |
| "url":"^http://commuprof\\.sakura\\.ne\\.jp/", | |
| "pageElement":"id('post-listing')/article", | |
| "nextLink":"//a[@class='nextpostslink']", | |
| "wedata.net.id":77726 | |
| }, | |
| { | |
| "url":"^http://plaza\\.rakuten\\.co\\.jp/dac", | |
| "pageElement":"id('articleList')/ul/li", | |
| "nextLink":"//div[contains(@class,\"pager\")]//span/following-sibling::a[1]", | |
| "wedata.net.id":2320 | |
| }, | |
| { | |
| "url":"^http://(anon-v|www\\.multixxx).com.+", | |
| "pageElement":"//div[@class=\"item \"]') | //div[@class=\"list_videos\"]/div[@class=\"block_content\"]/div[@class=\"item\"] | //div[@class=\"list_videos\"]/div[@class=\"block_content\"]/form/div[@class=\"item\"] | //div[@class=\"item\"]", | |
| "nextLink":"//li[@class=\\\"page-current\\\"]/following-sibling::li[1]/a[1] | //div[@class=\"pagination\"]/div[@class=\"block_content\"]/span/following-sibling::a[1]", | |
| "wedata.net.id":77329 | |
| }, | |
| { | |
| "url":"^http://query\\.nytimes\\.com/search/", | |
| "pageElement":"id('searchResults')/ol/li", | |
| "nextLink":"//a[@class='stepToPage next']", | |
| "wedata.net.id":25759 | |
| }, | |
| { | |
| "url":"^http://nikologla\\.blog27\\.fc2.com/", | |
| "pageElement":".//div[@class=\"table\"]", | |
| "nextLink":".//div[@class=\"page\"]/a[contains(text(),\"\u6b21\")]", | |
| "wedata.net.id":34062 | |
| }, | |
| { | |
| "url":"^https?://(www\\.)?filehorse\\.com/.+", | |
| "pageElement":"//ul[@class='software_list']/li[not(@class='ads')]", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":77135 | |
| }, | |
| { | |
| "url":"^http://blog\\.kushii\\.net/archives/", | |
| "pageElement":"//div[@class=\"article-body\"]|//div[@class=\"article-header-content\"]/*[not(@class=\"director-social-btn\")]", | |
| "nextLink":"//li[@class=\"prev\"]/a", | |
| "wedata.net.id":77342 | |
| }, | |
| { | |
| "url":"^http://lightroomkillertips\\.com/\\?", | |
| "pageElement":"//div[@class='recent-post clearfix']", | |
| "nextLink":"//div[@class='alignleft']/a", | |
| "wedata.net.id":32519 | |
| }, | |
| { | |
| "url":"^https://tokyo-calendar\\.jp/article/", | |
| "pageElement":"//div[@class='main-contents']/section[not(contains(@class,'next-page-paragraph'))]", | |
| "nextLink":"//link[@rel='next']", | |
| "wedata.net.id":77707 | |
| }, | |
| { | |
| "url":"^http://bbs\\d+\\.apricot-fizz\\.net/", | |
| "pageElement":"//div[@class=\"log2\"]", | |
| "nextLink":"//span[@class=\"seeker\"]/a[contains(text(),\"[次の\")]", | |
| "wedata.net.id":32002 | |
| }, | |
| { | |
| "url":"^http://www\\.baseballchannel\\.jp/.+", | |
| "pageElement":"id(\"omc-inner-placeholder\")/following-sibling::*[not(@class=\"nextpage\")][following::div[@class=\"pagesprit\"]]|//article[//link[@rel=\"canonical\"][contains(@href,\"http://www.baseballchannel.jp/new/\")]]", | |
| "nextLink":"//div[@class='nextpage']/a|//span[@class='current']/following-sibling::a[1]", | |
| "wedata.net.id":76430 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?kyounoryouri\\.jp/", | |
| "pageElement":"id('paging')/preceding-sibling::div[@class='row' or (@class='clear' and preceding-sibling::*[1][self::div/@class='row'])]|id('mainContent')/div[@class='paging']/preceding-sibling::div[@class='result3Ichiran' or @class='resultPageInfo']|id('recipeUser')/*[self::p or self::table]|id('ul_hub_recipe01')/article", | |
| "nextLink":"//*[@class='next' or @class='ico next']/a", | |
| "wedata.net.id":33982 | |
| }, | |
| { | |
| "url":"^http://www\\.portablefreeware\\.com/", | |
| "pageElement":"//div[starts-with(@class,'entry group ')]", | |
| "nextLink":"//li[@class='current']/following-sibling::li[1]/a", | |
| "wedata.net.id":32582 | |
| }, | |
| { | |
| "url":"^http://kakaku\\.com/research/report/", | |
| "pageElement":"//div[contains(concat(\" \",normalize-space(@class),\" \"), \" resultDetail \")]", | |
| "nextLink":"//a[contains(concat(\" \",normalize-space(@class),\" \"), \" next \")]", | |
| "wedata.net.id":41393 | |
| }, | |
| { | |
| "url":"^http://www\\.tomshardware\\.co\\.uk/", | |
| "pageElement":"id('news-content')/*|//ul[@class='result-list']/li[starts-with(@class,'result')]", | |
| "nextLink":"//a[@class='upper bold icon icon-chevron-right icon-rounded icon-spaceR10 icon-spaceL5 cDefault crLink']|//li[@class='unitR']/a", | |
| "wedata.net.id":32511 | |
| }, | |
| { | |
| "url":"^http://www\\.fatwallet\\.com/forums/", | |
| "pageElement":"(//span[starts-with(.,'Skipping ')]|id('quickReply')[not(//span[contains(.,'Skipping ')])])/preceding-sibling::table[starts-with(@class,'post ')]|//tr[starts-with(@class,'topicRow')]", | |
| "nextLink":"//link[@rel='next']", | |
| "wedata.net.id":29181 | |
| }, | |
| { | |
| "url":"^http://(?:appstore\\.)?modmyi\\.com/", | |
| "pageElement":"id('section_content')/div[starts-with(@class,'fullwidth')]", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":32510 | |
| }, | |
| { | |
| "url":"^https://www\\.doorkeeper\\.jp/events", | |
| "pageElement":"//div[@class='content event-list']/*", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":76877 | |
| }, | |
| { | |
| "url":"^http://www\\.aznovels\\.com/srh_book", | |
| "pageElement":"id(\"center\")/*[self::div/@class or self::a][//div/@class='k_shosai']|id('center')/table[not(@class)]//tr[not(//div/@class='k_shosai')]", | |
| "nextLink":"//a[normalize-space(.)='次へ>>']", | |
| "wedata.net.id":63200 | |
| }, | |
| { | |
| "url":"^http://ksklog\\.blog108\\.fc2\\.com/", | |
| "pageElement":"id(\"main-column\")/div[contains(@class,\"EntryBlock\")]", | |
| "nextLink":"//div[@class=\"pageLink\"]/a[last()]", | |
| "wedata.net.id":1907 | |
| }, | |
| { | |
| "url":"^http://digimaga\\.net/\\d{4}/\\d{2}/", | |
| "pageElement":"//div[@class='thm-article']", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":34779 | |
| }, | |
| { | |
| "url":"^http://4travel\\.jp/dynamic/camera/.", | |
| "pageElement":"//table[contains(@class,'blue_to_noline')]/tbody/tr", | |
| "nextLink":"//a[contains(.,'次のページへ')]", | |
| "wedata.net.id":30899 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?junkudo\\.co\\.jp/", | |
| "pageElement":"//div[@class='product_contents_1line']", | |
| "nextLink":"id('product_list_sort_under')/strong/following-sibling::a[1]", | |
| "wedata.net.id":46714 | |
| }, | |
| { | |
| "url":"^http://www\\.f2ff\\.jp/interop/2014/", | |
| "pageElement":"id(\"content\")/div[@class=\"section\"]", | |
| "nextLink":"//a[@class=\"link_next\"]", | |
| "wedata.net.id":77516 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?wi-fiplanet\\.com/", | |
| "pageElement":"//div[@class='body']/*[not(starts-with(.,\"Don't miss \"))]", | |
| "nextLink":"//p[starts-with(.,\"Don't miss \")]/a", | |
| "wedata.net.id":28160 | |
| }, | |
| { | |
| "url":"^http://www\\.askray\\.jp/nicky\\.cgi", | |
| "pageElement":"//div[@align=\"left\"][table and form]/a[@name][1]/preceding-sibling::*[1]/following-sibling::*", | |
| "nextLink":"//a[contains(.,\"OLD\")]", | |
| "wedata.net.id":64853 | |
| }, | |
| { | |
| "url":"^http://home\\.officesnapshots\\.com/", | |
| "pageElement":"id(\"content\")/div[@class=\"post\"]", | |
| "nextLink":"//a[contains(text(), \"Previous Entries\")]", | |
| "wedata.net.id":26097 | |
| }, | |
| { | |
| "url":"^http://www\\.okinawatimes\\.co\\.jp/", | |
| "pageElement":"id(\"detail_news_content\")/div[@class=\"top_news_body\"]", | |
| "nextLink":"//span[@class=\"nav_next\"]/a", | |
| "wedata.net.id":77075 | |
| }, | |
| { | |
| "url":"^https://forums.geforce.com/.*/topic/", | |
| "pageElement":"//div[contains(@class,'forumComment ')]", | |
| "nextLink":"//a[contains(img/@src,'next.png')]", | |
| "wedata.net.id":76471 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?hardsextube\\.com/", | |
| "pageElement":"//section/div[contains(@class,'video-item')] | //div[@class=\"video-items-feed\"]/div[contains(@class,\"video-item\")]", | |
| "nextLink":"//div[@class=\"btn-group-squared pagination\"]/a[last()] | //i[@class=\"icon icon-angle-right\"]/parent::a", | |
| "wedata.net.id":32503 | |
| }, | |
| { | |
| "url":"^http://mkosaki\\.blog46\\.fc2\\.com/", | |
| "pageElement":"//div[@class=\"entryBodybox\"]", | |
| "nextLink":"//div[@class=\"main\"]/div[@class=\"nav\"]/a[last()]|//div[@class=\"main\"]/a[contains(text(), \"\u6b21\")]", | |
| "wedata.net.id":54656 | |
| }, | |
| { | |
| "url":"^http://news\\.nicovideo\\.jp/search/", | |
| "pageElement":"id('BL_MAIN')/ul[@class='index']/li", | |
| "nextLink":"id('BL_MAIN')/ul[@class='pages']/li[@class='current']/following-sibling::li/a", | |
| "wedata.net.id":58257 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?twimono\\.com/mono", | |
| "pageElement":"id('ProductTemplateSearch')/tbody/tr/td", | |
| "nextLink":"//a[@class='page_next']", | |
| "wedata.net.id":31903 | |
| }, | |
| { | |
| "url":"^http://ichimichi\\.exblog\\.jp/\\d+/", | |
| "pageElement":"//div[@class=\"post\"]", | |
| "nextLink":"//a[@class=\"older_page\"]", | |
| "wedata.net.id":70092 | |
| }, | |
| { | |
| "url":"^http://m\\.hatena\\.(?:ne\\.jp|com)/", | |
| "pageElement":"//table[@class='list']/tbody/tr[td]", | |
| "nextLink":"id('body')/div[@class='pager-index']/a[contains(.,'>')]", | |
| "wedata.net.id":1478 | |
| }, | |
| { | |
| "url":"^http://blog\\.livedoor\\.(?:jp|com)/", | |
| "pageElement":"id(\"articlebody\")|id('rankingBlog')/ul[@class='list']/li", | |
| "nextLink":"//a[.='前の記事']|//nav/div[@class='nav']/p[@class='commonMore']/a", | |
| "wedata.net.id":1513 | |
| }, | |
| { | |
| "url":"^http://www\\.tokyo-sports\\.co\\.jp/", | |
| "pageElement":"id('font_report')", | |
| "nextLink":"id('font_report')/p/a[contains(text(),\"次のページ\")]|id('report_content')//span[@class=\"postpage\"]/span/following-sibling::a", | |
| "wedata.net.id":74303 | |
| }, | |
| { | |
| "url":"^http://www\\.readability\\.com/\\w+/", | |
| "pageElement":"id(\"rdb-reading-list\")", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":58794 | |
| }, | |
| { | |
| "url":"^https://.*startpage\\.com/do/search$", | |
| "pageElement":"//ol[@class='web_regular_results']/li", | |
| "nextLink":"id('nextnavbar')/form/a", | |
| "wedata.net.id":77556 | |
| }, | |
| { | |
| "url":"^http://www\\.originalmind\\.co\\.jp/", | |
| "pageElement":"//div[@id='wordBreakTable'][@class='clearfix']", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":76405 | |
| }, | |
| { | |
| "url":"^http://www\\.thedifferentscent\\.de/", | |
| "pageElement":"//table[@class='productListing']/tbody/tr[@class]", | |
| "nextLink":"//a[contains(.,'>')]", | |
| "wedata.net.id":32712 | |
| }, | |
| { | |
| "url":"^http://topwpthemes\\.com/(?:page/|$)", | |
| "pageElement":"id('content')/div[@class='grid_4' or @class='clear']", | |
| "nextLink":"//span[@class='current']/following-sibling::a[1]", | |
| "wedata.net.id":32718 | |
| }, | |
| { | |
| "url":"^http://blog\\.goo\\.ne\\.jp/atpaleys", | |
| "pageElement":".//div[@class=\"mod-entry-set\"]", | |
| "nextLink":".//li[@class=\"mod-pre-nex-prev\"]/a[child::node()[contains(text(),\"\u524d\")]]", | |
| "wedata.net.id":33394 | |
| }, | |
| { | |
| "url":"^http://[^./]+\\.cankaoxiaoxi\\.com/.", | |
| "pageElement":"//div[contains(@class, \"cont-detail\")]", | |
| "nextLink":"//div[contains(@class, \"page\")]//a[contains(text(),\"下一页\")]", | |
| "wedata.net.id":74990 | |
| }, | |
| { | |
| "url":"^https?://crowdworks\\.jp/public/jobs", | |
| "pageElement":"//ul[@class='jobs_lists']/li", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":65440 | |
| }, | |
| { | |
| "url":"^http://music-book\\.jp/([^/]+/)?news", | |
| "pageElement":"id('main')//section//ul/li[@itemscope]|//article/div[@class='news-contents']", | |
| "nextLink":"//li[@class='mod-paging-num-item'][b]/following-sibling::li/a|//p[@class='enlarge-image']/a|//div[@class='next']/a", | |
| "wedata.net.id":77757 | |
| }, | |
| { | |
| "url":"^http://www\\.uniprot\\.org/uniprot/.", | |
| "pageElement":"id('results')/tbody/tr", | |
| "nextLink":"//a[@class='nextPageLink']", | |
| "wedata.net.id":32017 | |
| }, | |
| { | |
| "url":"^http://www\\.starwipe\\.com/section/", | |
| "pageElement":"//div[@class='summary-list listing']/article", | |
| "nextLink":"//a[@class='pagination-next']", | |
| "wedata.net.id":77775 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?pornhublive\\.com/", | |
| "pageElement":"id(\"cam-container\")/*", | |
| "nextLink":"id(\"content\")//*[contains(concat(' ', @class, ' '), \" paginate \")]//li[contains(concat(' ', @class, ' '), \" active \")]/following-sibling::li[1]/a", | |
| "wedata.net.id":32749 | |
| }, | |
| { | |
| "url":"^http://www\\.smashingmagazine\\.com/", | |
| "pageElement":"id('content')/article", | |
| "nextLink":"//span[@class='nxt']/a", | |
| "wedata.net.id":1821 | |
| }, | |
| { | |
| "url":"^http://www\\.afpbb\\.com/articles/-/", | |
| "pageElement":"id(\"article-contents\")/div[contains(@class,\"article-body\")]/p", | |
| "nextLink":"//li[contains(concat(\" \",normalize-space(@class),\" \"),\" next \")]/a", | |
| "wedata.net.id":74699 | |
| }, | |
| { | |
| "url":"^http://kakaku\\.com/.+/ranking_\\d+/", | |
| "pageElement":"//div[@class=\"rkgContents\"]/div[contains(@class,\"rkgBox\")]", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":25667 | |
| }, | |
| { | |
| "url":"^http://www\\.st-image\\.com/category", | |
| "pageElement":"//ul[@class='item-list-type1']/li", | |
| "nextLink":"//p[@class='next active']/a", | |
| "wedata.net.id":48740 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?salchu\\.net/blog/", | |
| "pageElement":"id('contents')/*[@class='entry' or self::a]", | |
| "nextLink":"//span[@class='page_now']/following-sibling::a[1]", | |
| "wedata.net.id":1810 | |
| }, | |
| { | |
| "url":"^http://[^./]+\\.dmm\\.co(?:m|\\.jp)/", | |
| "pageElement":"//div[@class='d-item']/ul/li", | |
| "nextLink":"//link[@rel='next']|//li[@class='pager-next']/a|//div[contains(@class,'list-boxpagenation')]/ul/li[span]/following-sibling::li/a", | |
| "wedata.net.id":2137 | |
| }, | |
| { | |
| "url":"^http://www\\.magaseek\\.com/fw/list/", | |
| "pageElement":"id('branditemListContent')/div/*", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":62752 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?deviantclip\\.com/", | |
| "pageElement":"//div[@class=\"site-main\"]/div[@class=\"main-sectioncontent\"][1]", | |
| "nextLink":"//a[@rel=\"Next\"]", | |
| "wedata.net.id":32753 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?xvideoslive\\.com/", | |
| "pageElement":"id(\"cam-container\")/*", | |
| "nextLink":"//li[@class=\"active\"]/following-sibling::li[1]/a", | |
| "wedata.net.id":32490 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?enjoyfutsal\\.com/", | |
| "pageElement":"id(\"listArea\")/table//tr[position()>1]", | |
| "nextLink":"//li[contains(concat(\" \", @class, \" \"), \" nextTab \")]/a", | |
| "wedata.net.id":54437 | |
| }, | |
| { | |
| "url":"^http://www\\.typepad\\.com/dashboard", | |
| "pageElement":"id(\"activity-list\")/div[contains(@class,\"activity-item\")]", | |
| "nextLink":"id(\"content-inner\")/div[@class=\"content-dashboard pkg\"]/div[@class=\"content-main col\"]/div[@class=\"pagination-bar\"]/a[contains(text(),\"Next\")]", | |
| "wedata.net.id":29485 | |
| }, | |
| { | |
| "url":"http://members\\.naughtyamerica\\.com", | |
| "pageElement":"//*[@id=\"latest_block\"]", | |
| "nextLink":"//*[@id=\"latest_block\"]/ul[2]/li[13]/a", | |
| "wedata.net.id":80956 | |
| }, | |
| { | |
| "url":"^http://www\\.ali213\\.net/news/html/", | |
| "pageElement":"id(\"Content\")/p", | |
| "nextLink":"id(\"after_this_page\")", | |
| "wedata.net.id":55823 | |
| }, | |
| { | |
| "url":"^http://autoprove\\.net/\\?(?:cat|m)=", | |
| "pageElement":"//div[@class='gridrow clear']", | |
| "nextLink":"//a[@class='current']/following-sibling::a[1]", | |
| "wedata.net.id":36577 | |
| }, | |
| { | |
| "url":"^http://(www\\.|jp\\.)?xvideos\\.com/", | |
| "pageElement":"id(\"content\")/div[1]", | |
| "nextLink":"//a[.=\"Next\" or .=\"次へ\"]", | |
| "wedata.net.id":32489 | |
| }, | |
| { | |
| "url":"^http://www\\.sneakerbunko\\.jp/blog/", | |
| "pageElement":"id(\"id_blog\")/div[starts-with(@id,\"post-\")]", | |
| "nextLink":"//link[@rel=\"prev\"]|id(\"id_blog\")/div/div[@class=\"link\"]/a[last()]", | |
| "wedata.net.id":55274 | |
| }, | |
| { | |
| "url":"^http://magazine\\.kakaku\\.com/mag/.", | |
| "pageElement":"//div[@id='paging3'][1]/preceding-sibling::*", | |
| "nextLink":"//span[@class='pageNow']/following-sibling::a[1]", | |
| "wedata.net.id":55293 | |
| }, | |
| { | |
| "url":"^http://turenet\\.blog91\\.fc2\\.com/", | |
| "pageElement":"id(\"main\")/div[contains(@class, \"content\")]", | |
| "nextLink":"//a[last()][descendant::img[@src=\"http://blog17.fc2.com/u/usedpc/file/to_nextentry.gif\"]]", | |
| "wedata.net.id":1808 | |
| }, | |
| { | |
| "url":"^http://apidock\\.com/ruby/search\\?.", | |
| "pageElement":"id(\"main_body\")/div[contains(concat(\" \", @class, \" \"), \" result \")]", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":55299 | |
| }, | |
| { | |
| "url":"^https://sourceforge\\.net/directory/", | |
| "pageElement":"//ul[@class='projects']/li", | |
| "nextLink":"//ul[@class='paging']/li[last()]/a", | |
| "wedata.net.id":27470 | |
| }, | |
| { | |
| "url":"^http://www1\\.mangafreak\\.\\w{2,3}/", | |
| "pageElement":"//div[@class='bottomsup']/a", | |
| "nextLink":"//link[@rel='next']", | |
| "wedata.net.id":77620 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?brainyquote\\.com/", | |
| "pageElement":"id('quotesList')", | |
| "nextLink":"//li[@class='active']/following-sibling::a[1]", | |
| "wedata.net.id":30186 | |
| }, | |
| { | |
| "url":"^http://www\\.scroll-shop\\.com/shop/", | |
| "pageElement":"//div[@class='list-image']/*", | |
| "nextLink":"//link[@rel=\"next\"]", | |
| "wedata.net.id":49861 | |
| }, | |
| { | |
| "url":"^http://www\\.playhub\\.com/category/", | |
| "pageElement":"id(\"pagenumbers\")/preceding::table[1]", | |
| "nextLink":"id(\"pagenumbers\")/a[@class=\"active\"]/following-sibling::a[1]", | |
| "wedata.net.id":32771 | |
| }, | |
| { | |
| "url":"^http://playtv\\.fr/replay-tv/videos/", | |
| "pageElement":"//div[@class='pmd-ReplayContent-item']", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":80669 | |
| }, | |
| { | |
| "url":"^http://lu\\.scio\\.us/hentai/albums/", | |
| "pageElement":"//div[@class=\"picture\"]", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":33231 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)thumbzilla\\.com/.+", | |
| "pageElement":"//*[@id=\"content\"]/ul", | |
| "nextLink":"//a[text()=\"Next\"]", | |
| "wedata.net.id":77156 | |
| }, | |
| { | |
| "url":"^http://www\\.discogs\\.com/search\\?", | |
| "pageElement":"id(\"data\")/div[starts-with(@class, \"search_result\")]", | |
| "nextLink":"id(\"data\")/div[@align=\"center\"]/a[@class=\"pagelinknorm\"][starts-with(text(), \"Next\")]", | |
| "wedata.net.id":30201 | |
| }, | |
| { | |
| "url":"^http://(?:no|ww)w\\.nicochart\\.jp/.", | |
| "pageElement":"id('chart-table')/div[starts-with(@id,'rank')]", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":26568 | |
| }, | |
| { | |
| "url":"^http://mixi\\.jp/list_community\\.pl", | |
| "pageElement":"id(\"bodyMainArea\")/div//div[contains(@class,\"iconList03\")]", | |
| "nextLink":"id(\"bodyMainArea\")/div/div[contains(@class,\"pageNavigation01\")]/div/ul/li[@rel=\"__next\"]/a", | |
| "wedata.net.id":49863 | |
| }, | |
| { | |
| "url":"^http://(?:[^.]+\\.)+osakazine\\.net/", | |
| "pageElement":"id(\"content\")/div[@class=\"blog\"]/*[@class=\"date\" or @class=\"blogbody\"]", | |
| "nextLink":"id(\"content\")//div[@class=\"menu\"]/a[contains(.,\"\u6b21\u306e\")]", | |
| "wedata.net.id":30674 | |
| }, | |
| { | |
| "url":"^http://creative\\.adobe\\.com/addons", | |
| "pageElement":"//div[@class='ex_product_tile']", | |
| "nextLink":"//a[@class='next_page']", | |
| "wedata.net.id":32474 | |
| }, | |
| { | |
| "url":"^http://dev\\.mysql\\.com/doc/refman/", | |
| "pageElement":"//div[@class='section']", | |
| "nextLink":"id('docs-in-page-nav')/a[starts-with(@title,'Next: ')]", | |
| "wedata.net.id":513 | |
| }, | |
| { | |
| "url":"^http://www\\.maru-jan\\.com/content/", | |
| "pageElement":"id(\"textBody\")/*|id(\"column_contents\")/*", | |
| "nextLink":"id(\"next\")/a|id(\"navi03\")//div[@class=\"navigation_link\"][last()]//a", | |
| "wedata.net.id":74731 | |
| }, | |
| { | |
| "url":"^http://www\\.suppermariobroth\\.com/", | |
| "pageElement":"id('center')/*", | |
| "nextLink":"id('bottom')/div[last()-1]/a", | |
| "wedata.net.id":80704 | |
| }, | |
| { | |
| "url":"^http://galleria\\.emotionflow\\.com/", | |
| "pageElement":"//ul[@class='IllustThumbList']/li", | |
| "nextLink":"//a[@class='BtnBase PageBarItem'][.='>']", | |
| "wedata.net.id":77829 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?popsci\\.com\\.au/", | |
| "pageElement":"//div[@class='LatestStory']", | |
| "nextLink":"id('Paging_NextButton')", | |
| "wedata.net.id":2657 | |
| }, | |
| { | |
| "url":"^https?://akiba-souken\\.com/article/", | |
| "pageElement":"//div[@class='entryFrame']/node()[not(@class='entryFlm')]", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":74800 | |
| }, | |
| { | |
| "url":"^https://cse\\.google\\.com/cse\\?cx=", | |
| "pageElement":"//div[@class='gsc-webResult gsc-result']", | |
| "nextLink":"//div[@class='gsc-cursor-page gsc-cursor-current-page']/following-sibling::node()[1]", | |
| "wedata.net.id":60908 | |
| }, | |
| { | |
| "url":"^http://yaraon\\.blog109\\.fc2\\.com/", | |
| "pageElement":"//div[@class=\"index clearfix\" or @class=\"comment_area\" or @class=\"comment-form\"]", | |
| "nextLink":"id(\"page_navi\")/li[@id=\"centerLi\"]/following-sibling::li/a|//dl[@class=\"pagenav\"]/dd[last()]/a", | |
| "wedata.net.id":72679 | |
| }, | |
| { | |
| "url":"^http://www\\.sweetnote\\.com/board/.", | |
| "pageElement":"//div[@class='entry']", | |
| "nextLink":"//div[@class='pages']//a[.='次のページ']", | |
| "wedata.net.id":31695 | |
| }, | |
| { | |
| "url":"^http://www\\.tbs\\.co\\.jp/gacchiri/", | |
| "pageElement":"//div[@class=\"box clearfix\"][./div[@class=\"nextBtn\"]]/following-sibling::div[not(@id)]|//div[@class=\"box2 clearfix\"]", | |
| "nextLink":"//div[@class='nextBtn']/a|//div[@class='link']/a[contains(.,number(substring(//div[@class='title2']/h3/text(),1,4))-1)]", | |
| "wedata.net.id":62161 | |
| }, | |
| { | |
| "url":"^http://erodaioh\\.blog8\\.fc2\\.com/", | |
| "pageElement":"//div[@class=\"entry_box\"][./div[@class=\"entry-tag\"]]|//h1[@class=\"title\"]|//div[@class=\"entry_foot\"]", | |
| "nextLink":"id('foot')//div[@class='pagelink']/a[last()]", | |
| "wedata.net.id":76362 | |
| }, | |
| { | |
| "url":"^http://www\\.araiengine\\.com/sword/", | |
| "pageElement":"//td/p[@align=\"center\"]/preceding-sibling::*", | |
| "nextLink":"//p[@align=\"center\"]//a[.=\"Next\"]", | |
| "wedata.net.id":60950 | |
| }, | |
| { | |
| "url":"^http://codezine\\.jp/article/detail/", | |
| "pageElement":"//*[@class=\"topSection cf\" or @class=\"authorDetail cf\" or @class=\"h101\"][//a[@href=\"/article/corner/210\"]]|//div[@class=\"link\"][.//a[@href=\"/article/corner/210\"]]/preceding-sibling::table", | |
| "nextLink":"//div[@class=\"link\"]//td[1]//a[not(./img)]", | |
| "wedata.net.id":77468 | |
| }, | |
| { | |
| "url":"^http://up\\.mugitya\\.com/.*th\\.htm", | |
| "pageElement":"//center/table", | |
| "nextLink":"//a[contains(strong,'Old')]", | |
| "wedata.net.id":74934 | |
| }, | |
| { | |
| "url":"^http://www\\.geocities\\.jp/m_hiroi/", | |
| "pageElement":"//section[@class='contents']/*", | |
| "nextLink":"//div[@class='small']/a[contains(.,'NextPage')]", | |
| "wedata.net.id":32835 | |
| }, | |
| { | |
| "url":"^http://mypage\\.syosetu\\.com/mypage", | |
| "pageElement":"id('bloglistbg')/div|(id('blogbg')|id('blog_comment')/h3)[not(id('blog_comment')//div[@class='blogcomment_l']/a)]|//div[@class='comment_view']|id('novellist novelpointlist novelreviewlist')/ul|id('favuser')//li", | |
| "nextLink":"//a[@title='next page' or ../@class='blogcomment_r']|id('my_blog_l')/a[not(//a[../@class='blogcomment_r'])]", | |
| "wedata.net.id":76358 | |
| }, | |
| { | |
| "url":"^http://campus\\.nikki\\.ne\\.jp/\\?.", | |
| "pageElement":"//tr[@bgcolor=\"#eeeeee\" or @bgcolor=\"#ffffff\"]", | |
| "nextLink":"//span[@class=\"current\"]/following-sibling::a[1]", | |
| "wedata.net.id":2685 | |
| }, | |
| { | |
| "url":"^http://racoupon\\.rakuten\\.co\\.jp/", | |
| "pageElement":"//div[@id='couponWall']/div[contains(@class,'coupon-wall-item')][.//@class='coupon-wall-item__link ']", | |
| "nextLink":"//a[@class='pagination__next']", | |
| "wedata.net.id":77648 | |
| }, | |
| { | |
| "url":"^http://ikapani\\.blog55\\.fc2\\.com/", | |
| "pageElement":"id(\"left\")/div[contains(@class,\"content\")]", | |
| "nextLink":"id(\"left\")/a[text()=\"\u6b21\u306e\u30da\u30fc\u30b8\"]", | |
| "wedata.net.id":27631 | |
| }, | |
| { | |
| "url":"^http://gatoh\\.com/weblog/\\d+/\\d+/", | |
| "pageElement":"id('alpha-inner')[h1]/div[@class='content-nav']/preceding-sibling::*|id('alpha-inner')[not(./div[@class='content-nav'])]/div", | |
| "nextLink":"//link[contains(@rel,\"prev\")]", | |
| "wedata.net.id":33071 | |
| }, | |
| { | |
| "url":"^http://eva[0-3.]*\\.b-ch\\.com/blog/", | |
| "pageElement":"//td[@class=\"article1\"]/ancestor::table[1]/preceding-sibling::*", | |
| "nextLink":"//td[@class=\"article1\"][1]/a", | |
| "wedata.net.id":64698 | |
| }, | |
| { | |
| "url":"^http://www\\.akaneshinsha\\.co\\.jp/", | |
| "pageElement":"//div[@class=\"postlist-inner clearfix\"]", | |
| "nextLink":"//div[@class=\"pagenavi\"][count(./a)>1 or ./a[contains(@href,\"/page/2/\")]]/a[last()]|//div[@class=\"alignright pdgl10\"]/a", | |
| "wedata.net.id":64693 | |
| }, | |
| { | |
| "url":"^http://websearch\\.excite\\.co\\.jp/", | |
| "pageElement":"id('searchResults')//li", | |
| "nextLink":"//li[@class=\"next\"]/a", | |
| "wedata.net.id":30257 | |
| }, | |
| { | |
| "url":"^http://mediamarker\\.net/barter/list", | |
| "pageElement":"//table[@class='barter_list']/tbody/tr[td]", | |
| "nextLink":"//a[.='次へ']", | |
| "wedata.net.id":26770 | |
| }, | |
| { | |
| "url":"^http://tatakoubou\\.web\\.fc2\\.com/", | |
| "pageElement":"id(\"main\")/*", | |
| "nextLink":"//div[@class=\"center\"][1][count(./a)>2 or ./a[@href=\"2.html\"]]/a[2]", | |
| "wedata.net.id":72730 | |
| }, | |
| { | |
| "url":"^http://sicp\\.iijlab\\.net/fulltext/", | |
| "pageElement":"//p[@align='right']/following-sibling::node()", | |
| "nextLink":"//p[@align=\"right\"]/a[last()-1][not(@href=\"xexls.html\")]", | |
| "wedata.net.id":77295 | |
| }, | |
| { | |
| "url":"^http://(ichiba|qa)\\.nicovideo\\.jp/", | |
| "pageElement":"(id('rankingList')|//ul[@class='itemList' or @class='search_list']|//div[@class='matomegai']/ul)/li|id('adRanking')/tbody/tr[td]", | |
| "nextLink":"//ul[@class='pagenation']/li[@class='act']/following-sibling::li/a[1]|//a[(.|..)/@rel='next']", | |
| "wedata.net.id":2703 | |
| }, | |
| { | |
| "url":"^http://www\\.tousyoukai\\.jp/kikaku/", | |
| "pageElement":"//a[img[contains(@src,\"btn_next\")]]/preceding-sibling::table|//table[tbody/tr[count(td[@valign])=3]]", | |
| "nextLink":"//a[img[contains(@src,\"btn_next\") or contains(@src,\"next.gif\")]]", | |
| "wedata.net.id":61998 | |
| }, | |
| { | |
| "url":"^http://faha\\.biz/newpage\\d+\\.html", | |
| "pageElement":"//*[substring(@id,1,16)=\"_HPB_DIARY_TABLE\"]/tbody/tr", | |
| "nextLink":"//a[.//text()=\"前の月へ\"]", | |
| "wedata.net.id":66640 | |
| }, | |
| { | |
| "url":"^http://wakabamac.blog95\\.fc2\\.com/", | |
| "pageElement":"//div[@class=\"entries\"]", | |
| "nextLink":"//div[@class=\"pagenavi\"]/span/a[contains(text(),\"older\")]", | |
| "wedata.net.id":61939 | |
| }, | |
| { | |
| "url":"^http://www\\.geocities\\.jp/cba4jp/k", | |
| "pageElement":"//center/table", | |
| "nextLink":"//center//a[img] | //center//area", | |
| "wedata.net.id":38662 | |
| }, | |
| { | |
| "url":"^http://medical\\.nikkeibp\\.co\\.jp/", | |
| "pageElement":"//div[@class=\"article-body styled\"]", | |
| "nextLink":"//a[@class=\"next\"]", | |
| "wedata.net.id":2123 | |
| }, | |
| { | |
| "url":"^http://blog\\.goo\\.ne\\.jp/kuru0214", | |
| "insertBefore":"id(\"mod-prev-next\")", | |
| "pageElement":"id(\"in-center\")//div[@class=\"mod-entry-set\"]", | |
| "nextLink":"id(\"mod-prev-next\")//span[@class=\"etNextPrev\"]/parent::a", | |
| "wedata.net.id":55583 | |
| }, | |
| { | |
| "url":"^https?://(?:www\\.)?facepunch\\.com/", | |
| "pageElement":"id('threads')/tbody/tr", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":53144 | |
| }, | |
| { | |
| "url":"^http://novel\\.fc2\\.com/novel\\.php", | |
| "pageElement":"id(\"novel\")/div|id(\"main\")/div[@id]/div/*[contains(concat(\" \",@class,\" \"),\" list \")]", | |
| "nextLink":"id(\"novel\")/ul[@class=\"navi_page\"]/li[@class=\"right\"]/a|id(\"main\")/div[@id]/div/div[@class=\"navi_page\"]/span/following-sibling::a", | |
| "wedata.net.id":53320 | |
| }, | |
| { | |
| "url":"^https?://www\\.melonbooks\\.co\\.jp/", | |
| "pageElement":"//div[@class=\"sorts pt10 mb10 border_none\"]/following-sibling::*[following-sibling::div[@class=\"sorts pt10\"]]|//div[@class='products carousel viewmode_target' or div/@class='head']", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":77020 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?webdedb\\.com/cat/", | |
| "pageElement":"//div[@class=\"contentsbox\"]//div[@class=\"text\"][2]", | |
| "nextLink":"id(\"p_navi\")//a[starts-with(text(), \"\u6b21\u306e\u30da\u30fc\u30b8\")]", | |
| "wedata.net.id":27609 | |
| }, | |
| { | |
| "url":"^http://www\\.najdi\\.si/search\\.jsp", | |
| "pageElement":"//ul[@class='result_list']/li[div]", | |
| "nextLink":"id('page-next')", | |
| "wedata.net.id":38874 | |
| }, | |
| { | |
| "url":"^http://www\\.excite\\.co\\.jp/world/", | |
| "pageElement":"//div[@class=\"wordDetails\"]/p[@align=\"right\"]/preceding-sibling::node()", | |
| "nextLink":"//div[@class=\"wordDetails\"]/p[@align=\"right\"]/a", | |
| "wedata.net.id":30400 | |
| }, | |
| { | |
| "url":"^http://www\\.instructables\\.com/.+", | |
| "pageElement":"//ul[@class='h-list explore-covers-list clearfix']/li|//div[@class='step-container' or contains(@class,'entryList')]", | |
| "nextLink":"//div[starts-with(@class,'pagination ')]/ul/li[@class='active']/following-sibling::li[1]/a|//a[@rel='next']", | |
| "wedata.net.id":796 | |
| }, | |
| { | |
| "url":"^http://www2\\.sendai-c3\\.jp/logue/", | |
| "pageElement":"id('contents')", | |
| "nextLink":"id('nextPage')/a", | |
| "wedata.net.id":61632 | |
| }, | |
| { | |
| "url":"^http://kakaku\\.com/search_results/", | |
| "pageElement":"//div[contains(concat(\" \", @class, \" \"), \"item\") and contains(concat(\" \", @class, \" \"), \"clearfix\")]", | |
| "nextLink":"//li[@class=\"nextPage\"]/a", | |
| "wedata.net.id":2768 | |
| }, | |
| { | |
| "url":"^http://themonsterunderthebed\\.net/", | |
| "pageElement":"id(\"comic\")/a", | |
| "nextLink":"//td/a[@class=\"comic-nav-base comic-nav-next\"]", | |
| "wedata.net.id":77639 | |
| }, | |
| { | |
| "url":"^http://bandaancha\\.eu/foros/cable/", | |
| "pageElement":"//li[@class='topic']", | |
| "nextLink":"//link[@rel='next']", | |
| "wedata.net.id":27605 | |
| }, | |
| { | |
| "url":"^http://keika-search\\.com/index.php", | |
| "pageElement":"//table[@class=\"table021\"]", | |
| "nextLink":"//span[@class=\"fs12\"]/a[starts-with(text(),\"次のページ\")]", | |
| "wedata.net.id":80874 | |
| }, | |
| { | |
| "url":"^http://[^./]+\\.ja\\.utf8art\\.com/", | |
| "pageElement":"//div[@class='entries']/*", | |
| "nextLink":"//link[@rel='next']|//span[@class='current']/following-sibling::a", | |
| "wedata.net.id":66070 | |
| }, | |
| { | |
| "url":"^http://www\\.nicovideo\\.jp/search/", | |
| "pageElement":"//body/div/div/div/div/div/ul", | |
| "nextLink":"//a[@class='pagerBtn switchingBtn' and (text()='次へ')]", | |
| "wedata.net.id":77172 | |
| }, | |
| { | |
| "url":"^http://wuhuiyu1983\\.blogbus\\.com/", | |
| "pageElement":".//div[@class=\"post\"]", | |
| "nextLink":".//div[@class=\"pagenavi\"]/span/following-sibling::a[1]", | |
| "wedata.net.id":30315 | |
| }, | |
| { | |
| "url":"^http://bookstore\\.yahoo\\.co\\.jp/", | |
| "pageElement":"//div[@class=\"mod-itemList\"]/table", | |
| "nextLink":"//p[@class=\"next\"]/a", | |
| "wedata.net.id":53181 | |
| }, | |
| { | |
| "url":"^http://mngcow\\.co/[^/]+/[\\d\\.]+/", | |
| "pageElement":"//div[contains(@class,'prw')]", | |
| "nextLink":"//a[@class='page_nxt nxt-btn']", | |
| "wedata.net.id":77015 | |
| }, | |
| { | |
| "url":"^http://www\\.atmarkit\\.co\\.jp/im/", | |
| "pageElement":"id(\"centercol\")/p[@class=\"nextprev\" or span[@class=\"nextprev\"]]/following-sibling::node()[following-sibling::p[@class=\"nextprev\"] or following-sibling::p/span[@class=\"nextprev\"]]", | |
| "nextLink":"id(\"centercol\")//a[text()=\"\u6b21\u306e\u30da\u30fc\u30b8\" or strong[text()=\"\u6b21\u306e\u30da\u30fc\u30b8\"]]", | |
| "wedata.net.id":2086 | |
| }, | |
| { | |
| "url":"^http://www\\.theglobeandmail\\.com/", | |
| "pageElement":"//div[@class='entry-pagination']/preceding-sibling::*", | |
| "nextLink":"//a[(text()='Next')]", | |
| "wedata.net.id":74879 | |
| }, | |
| { | |
| "url":"^http://www\\.vector\\.co.jp/vpack/.", | |
| "pageElement":"id(\"subbody\")/ul[contains(concat(\" \",@class,\" \"),\" file_list \")]/li", | |
| "nextLink":"id(\"subbody\")/div[contains(concat(\" \",@class,\" \"),\" pagenav \") and last()]/node()[not(self::a) and (number(translate(self::text(),\"|\",\"\")) > 0)]/following-sibling::a[1]", | |
| "wedata.net.id":2353 | |
| }, | |
| { | |
| "url":"^http://www\\.lilformers\\.com/blog/", | |
| "pageElement":"//div[@class='comicpane']", | |
| "nextLink":"//div[@class='nav-next']/a", | |
| "wedata.net.id":73817 | |
| }, | |
| { | |
| "url":"^http://www\\.odyssey-com\\.co\\.jp/", | |
| "pageElement":"id(\"document\")/*", | |
| "nextLink":"id(\"navigation\")//a[contains(@href,number(substring(id(\"document\")/img/@alt,9,4))-1)]|id(\"navigation\")//a[contains(@href,number(substring(id(\"document\")/h1/img/@alt,12,4))-1)]", | |
| "wedata.net.id":61307 | |
| }, | |
| { | |
| "url":"^https?://www\\.lightinthebox\\.com/", | |
| "pageElement":"//div[contains(@class,\"product-list\") and contains(@class,\"pagelet\")]/*", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":77448 | |
| }, | |
| { | |
| "url":"^http://tv\\.yahoo\\.co\\.jp/review/", | |
| "pageElement":"//div[@class='commentContainer']", | |
| "nextLink":"//a[.='次の10件']", | |
| "wedata.net.id":26730 | |
| }, | |
| { | |
| "url":"^http://blog\\.goo\\.ne\\.jp/krmmk3/", | |
| "pageElement":"//div[@class='mod-entry-set']", | |
| "nextLink":"//li[@class='mod-pre-nex-prev']/a", | |
| "wedata.net.id":76322 | |
| }, | |
| { | |
| "url":"^http://filehippo\\.com/(.+/)?latest", | |
| "pageElement":"id('programs-list')/div[@class='program-entry']", | |
| "nextLink":"//a[@class='pager-next-link']", | |
| "wedata.net.id":32964 | |
| }, | |
| { | |
| "url":"^http://archiveofourown\\.org/works/", | |
| "pageElement":"id(\"chapters\")", | |
| "nextLink":"//li[@class=\"chapter next\"]/a", | |
| "wedata.net.id":74907 | |
| }, | |
| { | |
| "url":"^http://www\\.r6rs\\.org/final/html/", | |
| "pageElement":"id('slidecontent')/*[not(@class='navigation')]", | |
| "nextLink":"//div[@class='navigation']//a[.='next']", | |
| "wedata.net.id":2778 | |
| }, | |
| { | |
| "url":"^http://coderepos\\.org/share/search", | |
| "pageElement":"id(\"results\")", | |
| "nextLink":"//span[contains(concat(\" \",@class,\" \"),\" next \") and last()]/a", | |
| "wedata.net.id":1655 | |
| }, | |
| { | |
| "url":"^http://ma6works\\.mashupaward\\.jp/", | |
| "pageElement":"//div[@class=\"entry_list_wrap2\"]", | |
| "nextLink":"//div[@class=\"pager\"]//li[last()]/a", | |
| "wedata.net.id":39376 | |
| }, | |
| { | |
| "url":"^http://tokyo-reimei-note\\.com/2012", | |
| "pageElement":"id(\"contents\")/font[@size=\"2\"]/following-sibling::p[./font[@color=\"#dc143c\"]][1]/following-sibling::*[not(./a/strong)]|id(\"contents\")/font[@size=\"2\"]/following-sibling::p[./font[@color=\"#dc143c\"]][1]|id(\"contents\")/h2/following-sibling::*[not(count(./a)>1)][not(id(\"contents\")/font)]", | |
| "nextLink":"id(\"contents\")/p[last()][count(./a)=1]/a", | |
| "wedata.net.id":77628 | |
| }, | |
| { | |
| "url":"^http://www\\.akitashoten\\.co\\.jp/", | |
| "pageElement":"id('contents')[not(div/@class='news-content')]/div[@class='pager-box'][1]/following-sibling::* | //div[@class='news-content'][*]", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":64690 | |
| }, | |
| { | |
| "url":"^http://(?:[^./]+\\.)?youporn\\.com/", | |
| "pageElement":"id(\"pages\")/preceding-sibling::node()", | |
| "nextLink":"id(\"pages\")/a[@class=\"current\"]/following-sibling::a[1]", | |
| "wedata.net.id":1646 | |
| }, | |
| { | |
| "url":"^http://www\\.urbandictionary\\.com/", | |
| "pageElement":"//div[@class='def-panel']", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":558 | |
| }, | |
| { | |
| "url":"^https://career\\.nikkei\\.co\\.jp/.", | |
| "pageElement":"//ul[@class='modResultList01']/li", | |
| "nextLink":"//li[@class='next last']/a", | |
| "wedata.net.id":38635 | |
| }, | |
| { | |
| "url":"^http://www.dotbook\\.jp/magazine-k/", | |
| "pageElement":"//*[contains(concat(' ', normalize-space(@class), ' '), ' hentry ')]", | |
| "nextLink":"//div[@class='alignleft']/a", | |
| "wedata.net.id":65644 | |
| }, | |
| { | |
| "url":"^http://(?:[^.]+\\.)?autoc-one\\.jp/", | |
| "pageElement":"//div[@class=\"mod_La4-4 text clearfix\"]|//h3[@class=\"h3_type02\"]|//div[@class=\"pictures\"]/div[not(./ul)]", | |
| "nextLink":"//a[contains(img/@src,\"btn_next2.gif\")]|//ul[@class=\"new_pager\"]/li[@class=\"current\"]/following-sibling::li[1]/a", | |
| "wedata.net.id":28765 | |
| }, | |
| { | |
| "url":"^https?://agri-biz\\.jp/item/detail/", | |
| "pageElement":"id('entry')/div[@class='entry_body']/node()", | |
| "nextLink":"id('main')//ul[contains(@class, 'page_menu')]/li[@class='pag_m3']/a", | |
| "wedata.net.id":31689 | |
| }, | |
| { | |
| "url":"^http://(?:[^.]+\\.)?18stream\\.com/", | |
| "pageElement":".//div[@class=\"list-videos\"]", | |
| "nextLink":".//div[@class=\"pager\"]//li[child::span][1]/following-sibling::li[1]/a", | |
| "wedata.net.id":38412 | |
| }, | |
| { | |
| "url":"^http://punto-informatico\\.it/\\d+/", | |
| "pageElement":"//div[@class=\"testoContainer\"]/node()", | |
| "nextLink":"id(\"pageNavigator\")/a[contains(text(),\"continua\")]", | |
| "wedata.net.id":2823 | |
| }, | |
| { | |
| "url":"^http://search2\\.naturum\\.co\\.jp/", | |
| "pageElement":"//ul[@class='section']/li", | |
| "nextLink":"//a[.='次のページ>>']", | |
| "wedata.net.id":2827 | |
| }, | |
| { | |
| "url":"^http://www\\.fotocommunity\\.[^/]+/", | |
| "pageElement":"id('display_foto')|id('search_fotos')/div[starts-with(@id,'spalte')]", | |
| "nextLink":"id('nav_block_r')/div[@class='arrow_text']/a[@class='navigation_link']", | |
| "wedata.net.id":62155 | |
| }, | |
| { | |
| "url":"^http://www\\.dommune\\.com/reserve/", | |
| "pageElement":"//div[@class='reserveFormIn']/table/tbody/tr[not(td/@class='Bnr2')]", | |
| "nextLink":"//a[@class='Prev tooltip']", | |
| "wedata.net.id":64457 | |
| }, | |
| { | |
| "url":"^http://www\\.nikkeibp\\.co\\.jp/sj/", | |
| "pageElement":"id('leaf_body center')/div[@class='module' or @class='text']", | |
| "nextLink":"//a[(.|..)/@*='next'][last()]", | |
| "wedata.net.id":528 | |
| }, | |
| { | |
| "url":"^http://www.adastria\\.co\\.jp/news/", | |
| "pageElement":"//div[@class='mod-news-list-b']//li", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":65636 | |
| }, | |
| { | |
| "url":"^http://nanouchengrsgw\\.fang\\.com/", | |
| "pageElement":"//div[@class='listcomment']/div[last()]/ul", | |
| "nextLink":"//span[@class='dgrey fd']/following-sibling::a[1]", | |
| "wedata.net.id":64339 | |
| }, | |
| { | |
| "url":"^http://\\d+\\.teacup\\.com/\\w+/bbs", | |
| "pageElement":"//div[@class='row']/*[h3]", | |
| "nextLink":"//ul[@class=\"pagination\"]/li[last()]/a[not(@href=\"#\")]", | |
| "wedata.net.id":677 | |
| }, | |
| { | |
| "url":"^http://www\\.smallnetbuilder\\.com/", | |
| "pageElement":"//div[@class='pager'][1]/following-sibling::node()[following-sibling::div[@align or @style]]", | |
| "nextLink":"//li[@class='pagination-next']/a", | |
| "wedata.net.id":76507 | |
| }, | |
| { | |
| "url":"^http://www\\.soccerdigestweb\\.com/", | |
| "pageElement":"id('detail_main')/div[@class='pager']/preceding-sibling::*", | |
| "nextLink":"//a[.='次へ >']", | |
| "wedata.net.id":74753 | |
| }, | |
| { | |
| "url":"^http://upstart\\.bizjournals\\.com/", | |
| "pageElement":"//div[@class=\"col2of3 sectionNews\"]/section[1]/following-sibling::section[not(@class=\"pagination clearfix\")]", | |
| "nextLink":"//section[@class=\"pagination clearfix\"]/a[@class=\"rt\"]", | |
| "wedata.net.id":77666 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?alphaporno\\.com/", | |
| "pageElement":"//li[@class=\"thumb\"]", | |
| "nextLink":"//ul[@class=\"pagination-list\"]/li[@class=\"active\"]/following-sibling::li[1]/a", | |
| "wedata.net.id":50498 | |
| }, | |
| { | |
| "url":"^http://sweetshrimp\\.web\\.fc2.com/", | |
| "pageElement":"id(\"main\")", | |
| "nextLink":"//div[@class=\"center\"][./following-sibling::div[@id=\"main\"]]/a[last()]", | |
| "wedata.net.id":77048 | |
| }, | |
| { | |
| "url":"^http://webheibon\\.jp/blog/chagama/", | |
| "pageElement":"//div[starts-with(@id,\"entry-\")]", | |
| "nextLink":"//a[contains(text(),\"前\")]", | |
| "wedata.net.id":60595 | |
| }, | |
| { | |
| "url":"^http://live\\.nicovideo\\.jp/search", | |
| "pageElement":"//div[@class='cmn']/div[@class='result_list'][1]/*", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":33143 | |
| }, | |
| { | |
| "url":"^http://(?:[coru]\\.)?tabelog\\.com/", | |
| "pageElement":"//ul[contains(@class,'rstlist-info') or @class='ranking-list' or contains(concat(' ', @class, ' '), ' photograph-list ') or @class='rvwrlist-info' or @class='blogreview-list' or contains(concat(' ', @class, ' '), ' rstbm-list ') or @class='commu-list' or @class='list-result']/li|//div[@class='diary-list']|(//div|//table)[@class='list']/*|id('column-main')/div[@class='list-controll'][last()]/preceding-sibling::*[((self::a and @name) or (self::div and (contains(concat(' ', @class, ' '), ' review-wrap ')) or (self::p and @class='contents-up'))) and (count(../div[@class='list-controll'])=1 or preceding-sibling::div[@class='list-controll'])]|id('blogphoto-box')/*|id('thumphoto-list')", | |
| "nextLink":"//a[@class='next' or @rel='next']|//div[@class='page-move']/a[contains(., '>')]", | |
| "wedata.net.id":2019 | |
| }, | |
| { | |
| "url":"^http://(?:news\\.)?ringonoki\\.net/", | |
| "pageElement":"id('pager')/following-sibling::*[following-sibling::div[contains(concat(' ', @class, ' '), ' pager-container ')]][not(@class='headline')]", | |
| "nextLink":"id('pager')/descendant::a[contains(concat(' ', @class, ' '), ' next_page ')]", | |
| "wedata.net.id":37881 | |
| }, | |
| { | |
| "url":"^http://www\\.network54\\.com/Forum/", | |
| "pageElement":"//center/table[@width=\"94%\"]/descendant::ul[1]/*", | |
| "nextLink":"//a[contains(text(),\"Next\")][not(./ancestor::ul)]", | |
| "wedata.net.id":80705 | |
| }, | |
| { | |
| "url":"^http://www\\.nba\\.co\\.jp/nba/news", | |
| "pageElement":"//div[@class=\"pagination\"]/preceding-sibling::node()", | |
| "nextLink":"//a[@class=\"next rightArrow\"]", | |
| "wedata.net.id":77227 | |
| }, | |
| { | |
| "url":"^http://ch\\.nicovideo\\.jp/.+/video", | |
| "pageElement":"//ul[@class='items']/li", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":72600 | |
| }, | |
| { | |
| "url":"^https://github\\.com/.+?/stargazers", | |
| "pageElement":"id('repos')//ol", | |
| "nextLink":"//div[@class='pagination']//a[last()]", | |
| "wedata.net.id":77238 | |
| }, | |
| { | |
| "url":"^https://www\\.kinokuniya\\.co\\.jp/", | |
| "pageElement":"//div[@class='list_area_wrap' or @class='cInner']/div|//table[@class='b']//tr[td]", | |
| "nextLink":"//span[@class=\"anSpe2\"]/a[@class=\"next\"]|//div[@class=\"content-nav mb10\"]//li[./span[@class=\"current_page\"]]/following-sibling::li[1]/a", | |
| "wedata.net.id":72543 | |
| }, | |
| { | |
| "url":"^http://minkara\\.carview\\.co\\.jp/", | |
| "pageElement":"//div[@class='mainright']/table[@class='car-table']//tr|//ul[@class='pr_search_result_box']|//ul[@class='gallery-list-photo clearfix']/li", | |
| "nextLink":"//a[contains(@id,'lnkNext')]", | |
| "wedata.net.id":25601 | |
| }, | |
| { | |
| "url":"^http://ma7\\.mashupaward\\.jp/works", | |
| "pageElement":"//div[@class=\"section\"]/div[contains(concat(\" \", @class, \" \"), \" work_list_mod \")]", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":55803 | |
| }, | |
| { | |
| "url":"^https?://(www\\.)?steamgifts\\.com/", | |
| "pageElement":"//div[@class='page__heading__breadcrumbs']/following::div[1]/div[@class='giveaway__row-outer-wrap']", | |
| "nextLink":"//i[@class='fa fa-angle-right']/..", | |
| "wedata.net.id":62667 | |
| }, | |
| { | |
| "url":"^http://www\\.tabio\\.com/.+/search/", | |
| "pageElement":"//div[@class='item-list']//li", | |
| "nextLink":"//p[@class='next']/a", | |
| "wedata.net.id":36403 | |
| }, | |
| { | |
| "url":"^https?://jinjibu\\.jp/article/detl/", | |
| "pageElement":"id(\"leftColumn\")/div[2]/*[not(@class='btm10')]", | |
| "nextLink":"id(\"pagerBox\")/ul/li[@class=\"next\"]/a", | |
| "wedata.net.id":59945 | |
| }, | |
| { | |
| "url":"^http://www\\.komeri\\.com/(f|disp)/", | |
| "pageElement":"//div[@class='resultTable']//tr", | |
| "nextLink":"//p[@class='next']/a", | |
| "wedata.net.id":74979 | |
| }, | |
| { | |
| "url":"^http://www\\.ussearch\\.com/search/", | |
| "pageElement":"id('uss-teaser-results-table')/tbody/tr[td]", | |
| "nextLink":"id('uss-results-pagination')/a[contains(img/@src,'forward')]", | |
| "wedata.net.id":29212 | |
| }, | |
| { | |
| "url":"^https://projecteuler\\.net/archives", | |
| "pageElement":"id('problems_table')//tr[td]", | |
| "nextLink":"//a[@class='current']/following-sibling::a[1]", | |
| "wedata.net.id":76688 | |
| }, | |
| { | |
| "url":"^http://nanabatu\\.sakura\\.ne\\.jp/", | |
| "pageElement":"//dl/font/*", | |
| "nextLink":"//a[.='次へ']", | |
| "wedata.net.id":29945 | |
| }, | |
| { | |
| "url":"^http://kurosada\\.web\\.fc2\\.com/.", | |
| "pageElement":"//p", | |
| "nextLink":"//a[contains(text(), \"\u6b21\u3078\")]", | |
| "wedata.net.id":40759 | |
| }, | |
| { | |
| "url":"^http://www\\.ttrar\\.com/(new|html)", | |
| "pageElement":"//ul[@class='articlelist-ul']/li|//div[@class='left_base']", | |
| "nextLink":"//a[.='下一页']|//div[@class='nextpage']/a[2]", | |
| "wedata.net.id":74702 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?freepixels\\.com/", | |
| "pageElement":"//p[@class=\"text\"]/preceding-sibling::table[.//td[@class=\"thumb\"]]|id(\"left\")/div[@class=\"entry\"]", | |
| "nextLink":"//p[@class=\"text\"]/a[@title=\"Next Page\"]|id(\"left\")//span[@class=\"current\"]/following-sibling::a[1]", | |
| "wedata.net.id":26383 | |
| }, | |
| { | |
| "url":"^https://www.chikawatanabe.com/blog/", | |
| "pageElement":"id('content')", | |
| "nextLink":"//link[@rel='prev']", | |
| "wedata.net.id":70621 | |
| }, | |
| { | |
| "url":"^http://(?:[^.]+\\.)?oekakist\\.com/", | |
| "pageElement":"(//form|//table)[.//input[@checked]]/following-sibling::*[following::small]", | |
| "nextLink":"//small/a[b[contains(.,\"BACK\")]]|//small/b/following-sibling::a[number()>0]", | |
| "wedata.net.id":28964 | |
| }, | |
| { | |
| "url":"^http://trendnews\\.yahoo\\.co\\.jp/", | |
| "pageElement":"//div[@class='listCont']", | |
| "nextLink":"//p[@class=\"flR\"][//p[@class=\"pageCount\"]/em[2]/text()=1 or count(./a)>1]/a[last()]", | |
| "wedata.net.id":27850 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?nudography\\.com/", | |
| "pageElement":"id(\"News\")/*", | |
| "nextLink":"id(\"ctl00_ContentPlaceHolder1_hlPreviousPage\")", | |
| "wedata.net.id":35901 | |
| }, | |
| { | |
| "url":"^http://(?:doujin\\.)?moemilk\\.com/", | |
| "pageElement":"//div[@id='page']/div[2]", | |
| "nextLink":"id(\"nav-above\")/div[@class=\"nav-previous\"]/a", | |
| "wedata.net.id":65525 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?planet-php\\.org/", | |
| "pageElement":"//div[contains(@class, \"box\")]", | |
| "nextLink":"//span[1]/a", | |
| "wedata.net.id":1571 | |
| }, | |
| { | |
| "url":"^http://www\\.asse\\.co\\.jp/topics/", | |
| "pageElement":"id(\"news_list\")", | |
| "nextLink":"//a[contains(text(), \"次のページを見る\")]", | |
| "wedata.net.id":70093 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?gahako\\.com/.+?/", | |
| "pageElement":"id(\"comic_jump\")/*[not(@class=\"comic_nav\")]|//div[@class=\"comic_title_back\"][//div[@class=\"comic_nav\"]/a[last()][starts-with(@href, \"../\")]]", | |
| "nextLink":"id(\"comic_jump\")/a", | |
| "wedata.net.id":31306 | |
| }, | |
| { | |
| "url":"^http://www\\.muji\\.net/lab/report/", | |
| "pageElement":"id('contents')/*[not(@class='pagenav')]", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":31297 | |
| }, | |
| { | |
| "url":"^https?://reader\\.sensescans\\.com/", | |
| "pageElement":"//div[@class='group']", | |
| "nextLink":"//div[@class=\"next\"]/a[last()]", | |
| "wedata.net.id":80971 | |
| }, | |
| { | |
| "url":"^http://dododo30\\.blog\\.fc2\\.com/", | |
| "pageElement":"id(\"main_contents\")/div[@id]", | |
| "nextLink":"//a[@class=\"next nextpage\"]", | |
| "wedata.net.id":76248 | |
| }, | |
| { | |
| "url":"^http://www\\.soccerdigestweb\\.com/", | |
| "pageElement":"//div[@class=\"entry\"]", | |
| "nextLink":"//a[text()=\"次へ >\"]", | |
| "wedata.net.id":74999 | |
| }, | |
| { | |
| "url":"^http://[^./]+\\.blog\\.shinobi\\.jp", | |
| "pageElement":"id('EntryBlock')/div[@id='Wrappin']/*", | |
| "nextLink":"//a[.='<< ']", | |
| "wedata.net.id":65428 | |
| }, | |
| { | |
| "url":"^http://cookpad\\.com/(?!recipe/\\d)", | |
| "pageElement":"//div[@class='recipe-preview' or @class='request' or @class='question'] | id('tsukurepo-list')/div[starts-with(@class,'tsukurepo') or @class='clear']", | |
| "nextLink":"//a[@rel='next ']", | |
| "wedata.net.id":718 | |
| }, | |
| { | |
| "url":"^http://(?:[^./]+\\.)?whatpop\\.com/", | |
| "pageElement":"id('feedbox-group')/div", | |
| "nextLink":"id('bottom-tab')/li/a[contains(., '>>')]", | |
| "wedata.net.id":35331 | |
| }, | |
| { | |
| "url":"^http://diamond\\.jp/(sub)?category/", | |
| "pageElement":"//ul[starts-with(@class,'all-items')]/li", | |
| "nextLink":"//a[img/@alt='nextpage']", | |
| "wedata.net.id":724 | |
| }, | |
| { | |
| "url":"^http://www\\.gentosha-comics\\.net/", | |
| "pageElement":"//div[@class=\"leftcols\"]/*[not(@class=\"mab02\" or @class=\"entryPageLink\" or @class=\"pagenate\" or @class=\"catetitleheader\")]", | |
| "nextLink":"//a[@class=\"link_next\"] | //li[@class=\"previous\"]/a", | |
| "wedata.net.id":63177 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?hikaku\\.com/isp/", | |
| "pageElement":"//table[@class='resultTable']/tbody/tr[td]", | |
| "nextLink":"//li[span/@class='checked']/following-sibling::li[1]/a", | |
| "wedata.net.id":27198 | |
| }, | |
| { | |
| "url":"^http://www\\.washingtontimes\\.com/", | |
| "pageElement":"//div[@class='storyareawrapper']/*[not(a/em)]|//article[@class='story']", | |
| "nextLink":"//span[@class='next']/a", | |
| "wedata.net.id":35134 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?bellemaison\\.jp/", | |
| "pageElement":"//div[@class='f-clear mt20']", | |
| "nextLink":"//li[@class='current']/following-sibling::li[1]/a", | |
| "wedata.net.id":2515 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?the-hikaku\\.net/", | |
| "pageElement":"id('main-v2')/table[last()]/preceding-sibling::*[not(self::table or self::h1 or @class='update')]", | |
| "nextLink":"//a[contains(img/@src, \"next.gif\")]", | |
| "wedata.net.id":54609 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?sailormoon\\.biz/", | |
| "pageElement":"//td[@class=\"tableh1\"]/parent::tr[(./following-sibling::*)]/ancestor::table[1]|id(\"picinfo\")/../*[not(self::a[@name])]", | |
| "nextLink":"//td[@class=\"navmenu\"]/a[contains(@title, \"next\") or contains(./img/@title, \"Next\")]", | |
| "wedata.net.id":35133 | |
| }, | |
| { | |
| "url":"^http://www\\.vanadis-soft\\.com/wp/", | |
| "pageElement":"id(\"content\")/*[self::div[@class=\"post\"] or self::h3 or self::ol or self::form]", | |
| "nextLink":"id(\"content\")/div[@class=\"navigation\"]/div/a", | |
| "wedata.net.id":33443 | |
| }, | |
| { | |
| "url":"^http://www\\.pdb\\.org/pdb/results/", | |
| "pageElement":"//ul[@class='list-unstyled']/li", | |
| "nextLink":"//ul[@class='pagination']/li[a/strong]/following-sibling::li[1]/a", | |
| "wedata.net.id":32016 | |
| }, | |
| { | |
| "url":"^http://www\\.thesimpledollar\\.com/", | |
| "pageElement":"//div[@class='post'][div/@class='interior']", | |
| "nextLink":"//a[@class='next page-numbers']", | |
| "wedata.net.id":32610 | |
| }, | |
| { | |
| "url":"^http://burusoku-vip\\.com/archives/", | |
| "pageElement":"//div[@class='article-outer hentry' or @class='article-option-outer-2']", | |
| "nextLink":"//a[@rel='prev']", | |
| "wedata.net.id":80815 | |
| }, | |
| { | |
| "url":"^http://www\\.nfljapan\\.com/column/", | |
| "pageElement":"//div[@class=\"column_txt\"]/p[count(./a)=1]/text()[last()]/preceding-sibling::node()|//div[@class=\"column_txt\"]/p[count(./a)>1]/a[1]/preceding-sibling::text()[1]/preceding-sibling::node()", | |
| "nextLink":"//div[@class=\"column_txt\"]/p/a[contains(@href,\"column\")][not(./self::a/@href=//div[@class=\"snav_box\"]//td[1]/a/@href)][./b]", | |
| "wedata.net.id":77247 | |
| }, | |
| { | |
| "url":"^http://www\\.planetminecraft\\.com/", | |
| "pageElement":"//ul[@class='resource_list']/li", | |
| "nextLink":"//a[@class='pagination_next']", | |
| "wedata.net.id":76468 | |
| }, | |
| { | |
| "url":"^http://[^.]+\\.blog\\.shinobi\\.jp/", | |
| "pageElement":"id('EntryBlock contents')//div[@class='EntryInnerBlock' or @class='CommentBlock' or @class='TrackbackBlock' or @class='EntryCalenderBlock' or @class='entry'][not(@class='CommentBlock' and parent::td)]", | |
| "nextLink":"//a[.='Next ≫' or .='次のページ' or .='NEXT' or (@title='次のページへ' and .='》')]|//div[@class='PageLinkBlock'][last()]/a[last()]", | |
| "wedata.net.id":25712 | |
| }, | |
| { | |
| "url":"^https?://forum\\.sohovillage\\.com/", | |
| "pageElement":"//div[@class='col-md-8 columns'][1]//ul[@class='list-group']/li[@class='list-group-item']|//div[@class='group']", | |
| "nextLink":"//li[@class='active']/following-sibling::li/a[1]", | |
| "wedata.net.id":41270 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?fuq\\.com/search/", | |
| "pageElement":"//div[@class=\"thumbs\"]", | |
| "nextLink":"//div[@class=\"pageNumbers\"]/a[last()]", | |
| "wedata.net.id":63627 | |
| }, | |
| { | |
| "url":"^https?://(www\\.)?toyokeizai\\.net/", | |
| "pageElement":"id('article-body-inner')/*", | |
| "nextLink":"//span[@class='next']/a", | |
| "wedata.net.id":1857 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?iconseeker\\.com/", | |
| "pageElement":"//ul[@class='icons']/li", | |
| "nextLink":"id('jumpFormbottom')/a[.='Next']", | |
| "wedata.net.id":28053 | |
| }, | |
| { | |
| "url":"^http://tv\\.yahoo\\.co\\.jp/search/", | |
| "pageElement":"//ul[@class='programlist']/li", | |
| "nextLink":"//div[contains(@class,'pagelist')]/ul/li[span]/following-sibling::li[1]/a", | |
| "wedata.net.id":29786 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?boingboing\\.net/", | |
| "pageElement":"//div[@class='feature']", | |
| "nextLink":"//a[(..|h1)/@class='exhort']", | |
| "wedata.net.id":29182 | |
| }, | |
| { | |
| "url":"^http://www\\.toysrus\\.co\\.jp/disp", | |
| "pageElement":"//div[@class='sub-category-list cf']", | |
| "nextLink":"id('NEXT_SCREEN')", | |
| "wedata.net.id":30918 | |
| }, | |
| { | |
| "url":"^http://gura5\\.blog120\\.fc2\\.com/", | |
| "pageElement":"id('left')/h3[2]|//div[@class='body'][2]", | |
| "nextLink":"id('left')/a[last()]", | |
| "wedata.net.id":1863 | |
| }, | |
| { | |
| "url":"^http://www\\.giga-web\\.jp/search/.", | |
| "pageElement":"//div[@id=\"list\"]", | |
| "nextLink":"//li[@class=\"selected\"]/following-sibling::li[1]/a", | |
| "wedata.net.id":33765 | |
| }, | |
| { | |
| "url":"^http://www\\.kaiohsha\\.com/search/", | |
| "pageElement":"id('searchResult')//div[@class='contents']/*", | |
| "nextLink":"//div[@class='paging']/a[contains(.,'次の')]", | |
| "wedata.net.id":65375 | |
| }, | |
| { | |
| "url":"^http://www\\.mooter\\.co\\.jp/moot/", | |
| "pageElement":"id(\"main\")", | |
| "nextLink":"id(\"paging\")//img[contains(@src, \"/pagebtn_next.\")]/following-sibling::a", | |
| "wedata.net.id":29570 | |
| }, | |
| { | |
| "url":"^http://komachi\\.yomiuri\\.co\\.jp/", | |
| "pageElement":"//table[@class='topicslist']/tbody/tr[td] | id('reslist')", | |
| "nextLink":"//a[@class='nxt']", | |
| "wedata.net.id":758 | |
| }, | |
| { | |
| "url":"^http://www\\.adultgoods-sale\\.com/", | |
| "pageElement":"//tr[contains(@class,'productListing')]", | |
| "nextLink":"//a[@title=' 次ページ ']", | |
| "wedata.net.id":80810 | |
| }, | |
| { | |
| "url":"^http://builder\\.japan\\.zdnet.com/", | |
| "pageElement":"//div[@class=\"article_body\"]|id(\"block_story block_listing\")/*[not(@id=\"box_article_right\")]|id(\"wrapper\")/descendant::div[contains(concat(\" \", @class, \" \"), \" story_photoreport \")]|id(\"wrapper\")/descendant::div[contains(concat(\" \", @class, \" \"), \" article_body \")]/*[not(self::div[contains(concat(\" \", @class, \" \"), \" squarebadge \")])]", | |
| "nextLink":"//a[@id=\"script_pagination_next\" or @rel=\"next\" or @class=\"›\" or contains(concat(\" \", @class, \" \"), \" mediaNext \")]", | |
| "wedata.net.id":597 | |
| }, | |
| { | |
| "url":"^http://www\\.deguchi-hiroshi\\.com/", | |
| "pageElement":"id(\"main\")", | |
| "nextLink":"id(\"nextback\")/a[last()]", | |
| "wedata.net.id":63219 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?overthumbs\\.com/", | |
| "pageElement":"//a[@class=\"th-video\"]", | |
| "nextLink":"//a[@class=\"pag-next\"]", | |
| "wedata.net.id":57173 | |
| }, | |
| { | |
| "url":"^http://di\\.com\\.pl/(news|porady)/", | |
| "pageElement":"//div[(.|strong)/span/@class='strony data red']/preceding-sibling::*", | |
| "nextLink":"//span[@class='strony data red']/following-sibling::a[1]", | |
| "wedata.net.id":67122 | |
| }, | |
| { | |
| "url":"^http://blog\\.goo\\.ne\\.jp/a29ruiz", | |
| "pageElement":"id(\"in-center\")//div[contains(concat(\" \", @class, \" \"), \" mod-entry-set \")]", | |
| "nextLink":"id(\"mod-prev-next\")//li[contains(concat(\" \", @class, \" \"), \" mod-pre-nex-prev \")]/a", | |
| "wedata.net.id":41464 | |
| }, | |
| { | |
| "url":"^http://auction\\.rakuten\\.co\\.jp/", | |
| "pageElement":"id(\"resultList\")/ul[last()]", | |
| "nextLink":"//li[@class=\"next\"]/a", | |
| "wedata.net.id":63526 | |
| }, | |
| { | |
| "url":"^http://alsoku\\.blog47\\.fc2\\.com/", | |
| "pageElement":"id('contents-inner')/*[@class='main-entry' or self::br][following-sibling::br[last()]]", | |
| "nextLink":"//a[@title='次のページへ']", | |
| "wedata.net.id":1869 | |
| }, | |
| { | |
| "url":"^http://[^.]+\\.fotolia\\.com/search", | |
| "pageElement":"//div[@class='thumbs-list-inner']/div/a", | |
| "nextLink":"//a[span/@class='sp-10 ico-arrow-right-full']", | |
| "wedata.net.id":2235 | |
| }, | |
| { | |
| "url":"^http://ln-news\\.com/archives/\\d+/", | |
| "pageElement":"id('the-content')/p[last()]/preceding-sibling::p[1]/preceding-sibling::*", | |
| "nextLink":"//div[@class='page-link']/span/following-sibling::a[1]", | |
| "wedata.net.id":55998 | |
| }, | |
| { | |
| "url":"^http://iconfactory\\.com/freeware/.", | |
| "pageElement":"id('listing')/div", | |
| "nextLink":"id('next')/a", | |
| "wedata.net.id":2237 | |
| }, | |
| { | |
| "url":"^https?://[^.]+\\.backlog\\.jp/rev/.", | |
| "pageElement":"id(\"bodySection-col1\")", | |
| "nextLink":"id(\"revisionPagerSection\")/a[contains(text(), \"\u524d\u306e\u30ea\u30d3\u30b8\u30e7\u30f3\")]", | |
| "wedata.net.id":2258 | |
| }, | |
| { | |
| "url":"^http://carview\\.yahoo\\.co\\.jp/.+", | |
| "pageElement":"//div[@class='area-item']|//div[@class='section area-list']/ul/li", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":31042 | |
| }, | |
| { | |
| "url":"^http://alpha\\.mixi\\.co\\.jp/blog/", | |
| "pageElement":"//div[contains(concat(\" \",@class,\" \"),\" post \")]", | |
| "nextLink":"//a[contains(text(),\"\u6b21\u30da\u30fc\u30b8\u3078\")]|//link[@rel=\"prev\"]", | |
| "wedata.net.id":2286 | |
| }, | |
| { | |
| "url":"^http://www\\.akishobo\\.com/akichi/", | |
| "pageElement":"//div[@class=\"main\"]/div[@class=\"entry\"]", | |
| "nextLink":"//li[@class=\"this\"]/span/span/following-sibling::a", | |
| "wedata.net.id":77539 | |
| }, | |
| { | |
| "url":"^http://blog\\.trendmicro\\.co\\.jp/", | |
| "pageElement":"//div[starts-with(@id,'post-')][starts-with(@class,'post-')][not(//link/@rel='canonical')]|//p[contains(img/@src,'carat-up.gif')]/preceding-sibling::*", | |
| "nextLink":"//span[@class='skinSwitch current button tiny red']/following-sibling::a[1]|//a[img/@alt='次のページへ']", | |
| "wedata.net.id":29071 | |
| }, | |
| { | |
| "url":"^http://trendy\\.nikkeibp\\.co\\.jp/", | |
| "pageElement":"//div[@class='articlebody']|//ul[@class='list03']/li", | |
| "nextLink":"//a[@class='next' or .='次へ']", | |
| "wedata.net.id":1214 | |
| }, | |
| { | |
| "url":"^http://nan-net.com/show/bbs/log/.*/", | |
| "pageElement":"//div[@class=\"thread_wrapper\"]", | |
| "nextLink":"//a[text()=\"≫\"]", | |
| "wedata.net.id":74647 | |
| }, | |
| { | |
| "url":"^http://www\\.daytondailynews\\.com/", | |
| "pageElement":"//div[@class='cmList' or @class='cmList cmSearchResultsList']/*", | |
| "nextLink":"//a[@class='cmPaginationNext']", | |
| "wedata.net.id":34247 | |
| }, | |
| { | |
| "url":"^http://kakaku\\.com/specsearch/\\d+", | |
| "pageElement":"//tr[@class='bgColor02'][1]|//tr[@class='bgColor02'][1]/following-sibling::tr", | |
| "nextLink":"//a[img/@alt='次へ']", | |
| "wedata.net.id":80809 | |
| }, | |
| { | |
| "url":"^http://www\\.officedepot\\.co\\.jp/", | |
| "pageElement":"id('tableGroup')/tbody/tr", | |
| "nextLink":"//a[img/@alt='一つ進む']", | |
| "wedata.net.id":45761 | |
| }, | |
| { | |
| "url":"^http://www\\.inter-edu\\.com/forum/", | |
| "pageElement":"//div[@class='forum-list-table']//tbody/tr|//ol[@class='response-list']/li", | |
| "nextLink":"//div[@class='page-link']/ul/li[em]/following-sibling::li[1]/a", | |
| "wedata.net.id":43396 | |
| }, | |
| { | |
| "url":"^http://www\\.businessinsider\\.com/", | |
| "pageElement":"//div[@class='river']", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":77086 | |
| }, | |
| { | |
| "url":"^https://(?:[^./]+\\.)?giveapp\\.jp/", | |
| "pageElement":"//ul[@class='comment_box']/a", | |
| "nextLink":"//a[@class='left_btn']", | |
| "wedata.net.id":31079 | |
| }, | |
| { | |
| "url":"^http://www\\.zackzack\\.jp/u/topics", | |
| "pageElement":"//div[@class='entryUnit']", | |
| "nextLink":"//a[@class='selfPage']/following-sibling::a[1]", | |
| "wedata.net.id":31094 | |
| }, | |
| { | |
| "url":"^http://blogmag\\.ascii\\.jp/kodera/", | |
| "pageElement":"//div[@class=\"entrybody\"]", | |
| "nextLink":"//div[@class=\"entryback-next\"]/dl/dd[1]/p/a", | |
| "wedata.net.id":934 | |
| }, | |
| { | |
| "url":"^http://doupon\\.blog36\\.fc2\\.com/", | |
| "pageElement":"id(\"main\")/div", | |
| "nextLink":"//div[@class=\"page_navi2\"]/a[last()]", | |
| "wedata.net.id":1871 | |
| }, | |
| { | |
| "url":"^http://www\\.1101\\.com/restaurant/", | |
| "pageElement":"//div[starts-with(@class,\"main\")]", | |
| "nextLink":"//div[@class=\"back_next\"]//a[./img[contains(@src,\"next\")]]", | |
| "wedata.net.id":76914 | |
| }, | |
| { | |
| "url":"^http://www\\.akitashoten\\.co\\.jp/", | |
| "pageElement":"id('bookList newsList')//*[contains(@class,'line type') or self::li[contains(@class,'Category')]]", | |
| "nextLink":"//a[@class='next_page']", | |
| "wedata.net.id":77731 | |
| }, | |
| { | |
| "url":"^http://liosk\\.blog103\\.fc2\\.com/", | |
| "pageElement":"id('content')/div[@class='mod']", | |
| "nextLink":"//li[@class='navi_next']/a", | |
| "wedata.net.id":1127 | |
| }, | |
| { | |
| "url":"^http://visublog\\.mechafetus\\.com/", | |
| "pageElement":"id(\"nav-below\")/preceding-sibling::*", | |
| "nextLink":"id(\"wp_page_numbers\")/ul/li[@class=\"active_page\"]/following-sibling::li[1]/a", | |
| "wedata.net.id":25849 | |
| }, | |
| { | |
| "url":"^http://www\\.nedo\\.go\\.jp/search/", | |
| "pageElement":"//table[@class='tableSchLst']//tr[td]", | |
| "nextLink":"//div[@class='page']/a[contains(.,'次へ')]", | |
| "wedata.net.id":65309 | |
| }, | |
| { | |
| "url":"^http://l-wing\\.amaretto\\.jp/\\w+/", | |
| "pageElement":"//p[descendant::img]", | |
| "nextLink":"//p/descendant::a[contains(., \"\u2190\")]", | |
| "wedata.net.id":45684 | |
| }, | |
| { | |
| "url":"^http://pad\\.loveitsomuch\\.com/\\?", | |
| "pageElement":"//li[@class='item public_single_item']", | |
| "nextLink":"//p[@class='on']/following-sibling::p[1]/a", | |
| "wedata.net.id":32525 | |
| }, | |
| { | |
| "url":"^http://news\\.kakaku\\.com/prdnews/", | |
| "pageElement":"//div[@class='news']/*[self::h2 or @class='boxNews' or @class='boxNewsTop']", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":55455 | |
| }, | |
| { | |
| "url":"^http://www\\.chugoku-np\\.co\\.jp/", | |
| "pageElement":"(//div[@class='shadow'])[1]/*[not(@class='pagenation')]", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":80792 | |
| }, | |
| { | |
| "url":"^http://recipe\\.rakuten\\.co\\.jp/", | |
| "pageElement":"//div[@class=\"contentsBox\"]/div[1]//li", | |
| "nextLink":"id(\"pager_next\")", | |
| "wedata.net.id":45587 | |
| }, | |
| { | |
| "url":"^http://cygwin\\.com/cygwin-ug-net/", | |
| "pageElement":"//div[@class='book' or @class='chapter' or @class='sect1']/*", | |
| "nextLink":"//a[@accesskey='n']", | |
| "wedata.net.id":74635 | |
| }, | |
| { | |
| "url":"^http://boards\\.4chan\\.org/[^.]+/", | |
| "pageElement":"//div[@class='board']", | |
| "nextLink":"//div[@class='pages']/strong/following-sibling::a", | |
| "wedata.net.id":65231 | |
| }, | |
| { | |
| "url":"^http://[^./]+\\.androidzoom\\.com/", | |
| "pageElement":"id(\"searchResults\")/ul[contains(concat(\" \", @class, \" \"), \" applications \")]", | |
| "nextLink":"//li[contains(concat(\" \", @class, \" \"), \" next \")]/a", | |
| "wedata.net.id":31078 | |
| }, | |
| { | |
| "url":"^http://freefall\\.purrsia\\.com/ff", | |
| "pageElement":"descendant::img[last()]", | |
| "nextLink":"//a[contains(.,'Next')]", | |
| "wedata.net.id":80805 | |
| }, | |
| { | |
| "url":"^http://(?:[^.]+\\.)?miterew\\.com/", | |
| "pageElement":"id(\"MovieListBox\")/div[starts-with(@id,\"ID_\") or @id=\"NotFound\"]", | |
| "nextLink":"id(\"pagenation\")/a[@class=\"paging_next\"]|id(\"pagenation3 pagenation4\")/a[contains(concat(\" \",@class,\" \"),\" p_n \")]", | |
| "wedata.net.id":2390 | |
| }, | |
| { | |
| "url":"^http://www\\.boxofficescoop\\.com/", | |
| "pageElement":"//div[@class='page-links']/preceding-sibling::node()", | |
| "nextLink":"//div[@class='page-links']/text()[substring-after(.,'of ')-substring-before(.,' of')>2]/following-sibling::a", | |
| "wedata.net.id":76450 | |
| }, | |
| { | |
| "url":"^http://www\\.codegate.co\\.uk/blog", | |
| "pageElement":"//div[@class='col-xs-12']", | |
| "nextLink":"//ul[@class='pagination']/li[@class='active']/following-sibling::li[1]/a", | |
| "wedata.net.id":42138 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?gianttube\\.com/", | |
| "pageElement":"//div[@class=\"thumb\"]", | |
| "nextLink":"//a[@class=\"active\"]/following-sibling::a[1]", | |
| "wedata.net.id":57128 | |
| }, | |
| { | |
| "url":"^http://www\\.hemenindir\\.download", | |
| "pageElement":"id('sort')", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":76888 | |
| }, | |
| { | |
| "url":"^http://shogipenclublog\\.com/blog/", | |
| "pageElement":"//article[not(contains(@id,\"comment\"))]|id(\"comments\")", | |
| "nextLink":"//a[@class=\"next page-numbers\" or @rel=\"prev\"]", | |
| "wedata.net.id":77344 | |
| }, | |
| { | |
| "url":"^http://chneukirchen\\.org/trivium/", | |
| "pageElement":"//*[contains(@class,\"hentry\")]", | |
| "nextLink":"//a[contains(@class,\"prev\")]", | |
| "wedata.net.id":64967 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?gutenberg\\.org/", | |
| "pageElement":"//ul[@class='results']", | |
| "nextLink":"//a[@title='Go to the next page of results.']", | |
| "wedata.net.id":57150 | |
| }, | |
| { | |
| "url":"^http://up\\.b9dm\\.com/index\\.php", | |
| "pageElement":"//div[@class=\"pl2 content_box border space\"]|//div[@class=\"pl2 content_box border\"]", | |
| "nextLink":"id(\"multi_page\")/a[@class=\"nextpage\"]", | |
| "wedata.net.id":27276 | |
| }, | |
| { | |
| "url":"^https?://(www\\.)?usejquery\\.com/", | |
| "pageElement":"//div[@class='view-content']/div", | |
| "nextLink":"//li[@class='pager-next']/a", | |
| "wedata.net.id":29061 | |
| }, | |
| { | |
| "url":"^http://www\\.alphapolis\\.co\\.jp/", | |
| "pageElement":"//div[contains(concat(' ',normalize-space(@class),' '),' disp_option ')]/following-sibling::*[following-sibling::div[contains(concat(' ',normalize-space(@class),' '),' disp_option ')]]", | |
| "nextLink":"//span[@class='current']/following-sibling::a[1]", | |
| "wedata.net.id":76884 | |
| }, | |
| { | |
| "url":"^http://(www\\.)?logsoku\\.com/bbs/", | |
| "pageElement":"//div[@class='bbs-thread-list']//tbody/tr", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":57155 | |
| }, | |
| { | |
| "url":"^http://www\\.travelerstoday\\.com/", | |
| "pageElement":"//div[@class='cts_left']/*[preceding-sibling::h4][following-sibling::p/@class='clr mb20']", | |
| "nextLink":"//span[@class='gry']/following-sibling::span[1]/a", | |
| "wedata.net.id":76922 | |
| }, | |
| { | |
| "url":"^http://www\\.famitsu\\.com/images/", | |
| "pageElement":"//div[@class='mainImg']", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":57322 | |
| }, | |
| { | |
| "url":"^http://www\\.good-tutorials\\.com/", | |
| "pageElement":"//div[@class=\"tutorial\"]", | |
| "nextLink":"//div[@class=\"pagination\"]/a[last()]", | |
| "wedata.net.id":27459 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?sluttyred\\.com/", | |
| "pageElement":"id(\"miniartury\")/div[@id=\"miniatura\"]", | |
| "nextLink":"id(\"pagination\")/div/span[number()>0]/following-sibling::a[1]", | |
| "wedata.net.id":55958 | |
| }, | |
| { | |
| "url":"http://(wiiu|ps4|xboxone)daily.com/", | |
| "pageElement":"(id('posts-area')|//div[@class='postbg'])/div|//div[@class='article clearfix']", | |
| "nextLink":"//li[@class='btn btn-default btn-lg active']/following-sibling::li[1]/a", | |
| "wedata.net.id":77199 | |
| }, | |
| { | |
| "url":"^http://www\\.smwcentral\\.net/\\?p", | |
| "pageElement":"//tr[td/@class='normal border']/following-sibling::tr[td/@class='normal border cell2']|//tr[td/@class='postsidebar']|//table[@class='generic']//tr[td/@class='header']/following-sibling::tr[td[contains(@class,'center')]]", | |
| "nextLink":"//td[@class='normal border' or @class='cell1']//img/following-sibling::a[last()]|//td[@class='normal border' or @class='cell1']//a[1][./img]/following-sibling::a[last()][not(./following-sibling::img)]", | |
| "wedata.net.id":74669 | |
| }, | |
| { | |
| "url":"^http://diary\\.kameleon\\.co\\.jp/", | |
| "pageElement":"id(\"content\")/*", | |
| "nextLink":"//div[@class=\"alignright\"]/a", | |
| "wedata.net.id":64895 | |
| }, | |
| { | |
| "url":"^http://ceskapozice\\.lidovky\\.cz/", | |
| "pageElement":"//div[@class='art ']", | |
| "nextLink":"//a[@class='current']/following-sibling::a[1]", | |
| "wedata.net.id":64893 | |
| }, | |
| { | |
| "url":"^http://book\\.tsuhankensaku\\.com/", | |
| "pageElement":"id('contentContainer')/table", | |
| "nextLink":"//span[@class='nowthis']/following-sibling::span/a", | |
| "wedata.net.id":76876 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?jiji\\.com/jc/d4", | |
| "pageElement":"id(\"pic-frame\")", | |
| "nextLink":"//img[@src=\"http://www.jiji.com/img/photo-gallery_bt-next.gif\"]/..", | |
| "wedata.net.id":46911 | |
| }, | |
| { | |
| "url":"^http://www\\.wandoujia\\.com/award", | |
| "pageElement":"//div[@class='list-wrap']//li", | |
| "nextLink":"//a[.='下一页']", | |
| "wedata.net.id":74365 | |
| }, | |
| { | |
| "url":"^https?://news\\.ycombinator\\.com/", | |
| "pageElement":"//table[@class=\"itemlist\"]//tr[last()]/preceding-sibling::tr", | |
| "nextLink":"//table[@class=\"itemlist\"]//tr[last()]/a", | |
| "wedata.net.id":30892 | |
| }, | |
| { | |
| "url":"^https?://(?:raws\\.)?yomanga\\.co/", | |
| "pageElement":"id(\"page\")/div/a[img]|//div[@class=\"list series\"]/div[@class=\"group\"]", | |
| "nextLink":"id(\"page\")/div/a[img]|//div[@class=\"prevnext\"]//a[.=\"Next »\"]", | |
| "wedata.net.id":80765 | |
| }, | |
| { | |
| "url":"^https?://[^?#]+\\.proboards\\.com/", | |
| "pageElement":"//table[@class='list']/tbody/tr[not(.//img[contains(@alt,'Announce')])]", | |
| "nextLink":"//link[@rel='next']", | |
| "wedata.net.id":41269 | |
| }, | |
| { | |
| "url":"^http://code\\.openhub\\.net/search", | |
| "pageElement":"id('snippet_results')/div[starts-with(@class,'snippetResult')]", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":58113 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?hb-nippon\\.com/", | |
| "pageElement":"//div[@class=\"article_wrap\"]/p[1][./following-sibling::div[@class=\"para_title_blue\"] or ./following-sibling::div[@class=\"device_box\"]]/following-sibling::*|//ul[@class=\"list\"]/li|//dl[@class=\"newslist_sky\"]/*|//div[@class=\"article_wrap\"][./div[@class=\"para_title_blue\"][not(./preceding-sibling::p)]]/*", | |
| "nextLink":"id(\"maincontents\")/div[@class=\"pagination\"]//li[last()]/a[not(@href=\"/column/437-baseballclub/8348-20140313no124?page=2\")]", | |
| "wedata.net.id":58377 | |
| }, | |
| { | |
| "url":"^http://(www|info)\\.3gokushi\\.jp/", | |
| "pageElement":"//div[@class=\"allow_next\"]/preceding-sibling::*|//table[@class=\"commonTables\"]//tr", | |
| "nextLink":"//div[@class='allow_next']/a|id('pager')/li[./a[@class='cur']]/following-sibling::li[1]/a", | |
| "wedata.net.id":29184 | |
| }, | |
| { | |
| "url":"^http://tools4hack\\.santalab\\.me/", | |
| "pageElement":"//div[contains(@class,'post-')]|//hr[@class='entry-margin']", | |
| "nextLink":"//a[@class='next page-numbers']", | |
| "wedata.net.id":58686 | |
| }, | |
| { | |
| "url":"^http://b\\.hatena\\.ne\\.jp/search", | |
| "pageElement":"id('search-result-lists')//li", | |
| "nextLink":"//a[@class='pager-next']", | |
| "wedata.net.id":59018 | |
| }, | |
| { | |
| "url":"^http://mixi\\.jp/recent_voice\\.pl", | |
| "pageElement":"id(\"listArea\")/ul[contains(concat(\" \",@class,\" \"),\" listArea \")]", | |
| "nextLink":"id(\"listArea\")/div[contains(concat(\" \",@class,\" \"),\" pageNavigation01 \")]//a[contains(.,\"\u6b21\")]", | |
| "wedata.net.id":40987 | |
| }, | |
| { | |
| "url":"^http://www\\.tabletpcreview\\.com/", | |
| "pageElement":"(id('review_summaryTab')|//section[@class='contentListContainer'])/div", | |
| "nextLink":"//link[@rel='next']", | |
| "wedata.net.id":76972 | |
| }, | |
| { | |
| "url":"^http://oakla\\.com/(category|\\?s)", | |
| "pageElement":"id('post_list')/li", | |
| "nextLink":"//a[@class='next page-numbers']", | |
| "wedata.net.id":65448 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?streamate\\.com/", | |
| "pageElement":"//ul[@class=\"the-grid\"]/li", | |
| "nextLink":"//ul[@class=\"pagination\"]/li[./a][last()]/a", | |
| "wedata.net.id":32741 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?macupdate\\.com/", | |
| "pageElement":"//div[@class='nfml-update-list-rows']", | |
| "nextLink":"//a[@class='nfmlulp-btn nextbtn']", | |
| "wedata.net.id":2205 | |
| }, | |
| { | |
| "url":"http://review\\.kakaku\\.com/review", | |
| "pageElement":"//div[@class=\"reviewBox ver2013 boxGr\"]", | |
| "nextLink":"//a[@class=\"arrowNext01\"]", | |
| "wedata.net.id":74691 | |
| }, | |
| { | |
| "url":"^http://www\\.cycly\\.co\\.jp/Shop/", | |
| "pageElement":"//div[@class=\"media newitem\"]", | |
| "nextLink":"//a[@title=\"次へ\"]", | |
| "wedata.net.id":64781 | |
| }, | |
| { | |
| "url":"^http://www\\.alternet\\.org/search", | |
| "pageElement":"//ol/li", | |
| "nextLink":"//li[@class='pager-next']/a", | |
| "wedata.net.id":30765 | |
| }, | |
| { | |
| "url":"^http://www\\.movienewsguide\\.com/", | |
| "pageElement":"//script[1]", | |
| "nextLink":"//a[.='Contact Us']", | |
| "wedata.net.id":77420 | |
| }, | |
| { | |
| "url":"^http://www\\.initial-kurita\\.com/", | |
| "pageElement":"id(\"content\")/div[@class='blog']", | |
| "nextLink":"//div[@class=\"navi\"][last()][./a[contains(@href,\"index-\") or contains(@href,\"category\")]][not(./a[1]/@href=./a[last()]/@href) or ./a[1][contains(@href,\"-2.html\")]]/a[last()]|//div[@class=\"navi\"][./a[contains(@href,\"article\")]]/a[1][not(@href=\"http://www.initial-kurita.com/\")]|//div[@class=\"navi\"][last()][./a[contains(@href,\"archives\") and contains(@href,\"-2.html\")]]/a[last()]|//div[@class=\"navi\"][1]/a[1][not(@href=\"http://www.initial-kurita.com/\")][//div[@class=\"navi\"][last()][./a[contains(@href,\"archives\") and not(contains(@href,\"-2.html\"))]]]", | |
| "wedata.net.id":30761 | |
| }, | |
| { | |
| "url":"^http://www\\.sankakucomplex\\.com/", | |
| "pageElement":"//div[@id='posts']/div[@class='post']", | |
| "nextLink":"//div[@class='wp-pagenavi']/a[text()='»']", | |
| "wedata.net.id":74700 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?youjizzlive.com/", | |
| "pageElement":"id(\"cam-container\")/*", | |
| "nextLink":"id(\"content\")/ul[@class=\"paginate\"]/li[@class=\"active\"]/following-sibling::li[1]/a", | |
| "wedata.net.id":32750 | |
| }, | |
| { | |
| "url":"^http://www\\.studiobriefing\\.net/", | |
| "pageElement":"//div[@class='post']/*[not(@style)][preceding-sibling::div/@class='breadcrumb'][following-sibling::*[em/div/@class='postmeta' or div/a/@rel or a='Next Page »']]", | |
| "nextLink":"//a[.='Previous' or .='Next Page »']", | |
| "wedata.net.id":74721 | |
| }, | |
| { | |
| "url":"^https://joysound\\.com/web/search/", | |
| "pageElement":"//li[@class='ng-scope']", | |
| "nextLink":"//a[@class='jp-cmp-btn-pager-next ng-binding']", | |
| "wedata.net.id":40594 | |
| }, | |
| { | |
| "url":"^https?://bato\\.to/forums/members/", | |
| "pageElement":"id(\"mlist_content\")/ul", | |
| "nextLink":"//link[@rel=\"next\"]", | |
| "wedata.net.id":49219 | |
| }, | |
| { | |
| "url":"^http://www\\.sankeibiz\\.jp/search", | |
| "pageElement":"id('popin_content_main')/ul/li", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":80832 | |
| }, | |
| { | |
| "url":"^http://sakanapansya\\.tumblr\\.com", | |
| "pageElement":"id(\"content\")", | |
| "nextLink":"//li[@class=\"current-page\"]/following-sibling::li[1]/a", | |
| "wedata.net.id":77191 | |
| }, | |
| { | |
| "url":"^http://www\\.mammo\\.tv/interview/", | |
| "pageElement":"id('nav')/preceding-sibling::*", | |
| "nextLink":"id('nav')/a[1]", | |
| "wedata.net.id":60216 | |
| }, | |
| { | |
| "url":"^http://www\\.officialcharts\\.com/", | |
| "pageElement":"//div[@class='news-list-content']//li", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":76978 | |
| }, | |
| { | |
| "url":"^http://blog\\.goo\\.ne\\.jp/portal", | |
| "pageElement":"//table[@class='table-striped fs14']/tbody/tr", | |
| "nextLink":"id('page_link_next')", | |
| "wedata.net.id":2591 | |
| }, | |
| { | |
| "url":"^http://www\\.mydigitallife\\.info/", | |
| "pageElement":"//div[@class='postItem']", | |
| "nextLink":"//a[@class='emm-next']", | |
| "wedata.net.id":76984 | |
| }, | |
| { | |
| "url":"^http://review\\.rakuten\\.co\\.jp/", | |
| "pageElement":"//div[@class=\"revRvwUserSec hreview\"]", | |
| "nextLink":"//span[@class=\"revThisPage\"]/following-sibling::a[1]", | |
| "wedata.net.id":26955 | |
| }, | |
| { | |
| "url":"^http://www\\.pixiv\\.net/info.php?", | |
| "pageElement":"//ul[@class=\"type_entrylist\"][./li]", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":76990 | |
| }, | |
| { | |
| "url":"^http://www\\.littlemore\\.co\\.jp/", | |
| "pageElement":"//div[contains(@class,\"post-\")]", | |
| "nextLink":"//a[@rel=\"next\"]|//div[@class=\"menu\"]//li[./a[contains(@href,concat(concat(substring-before(//div[contains(@class,\"post-\")][1]/h3/text(),\".\"),\"/\"),substring-before(substring-after(//div[contains(@class,\"post-\")][1]/h3/text(),\".\"),\".\")))]]/following-sibling::li[1]/a", | |
| "wedata.net.id":77182 | |
| }, | |
| { | |
| "url":"^http://www\\.justjared(jr)?\\.com/", | |
| "pageElement":"id('content')/div[@class='post']", | |
| "nextLink":"//a[(text()='Next »')]", | |
| "wedata.net.id":74743 | |
| }, | |
| { | |
| "url":"^http://www\\.mediafreakcity\\.com/", | |
| "pageElement":"//div[contains(concat(' ',@class,' '),' main-unit2 ')]/table//tr", | |
| "nextLink":"//div[contains(concat(' ',@class,' '),' pagination ')]//a[last()][@class='backnext']", | |
| "wedata.net.id":60875 | |
| }, | |
| { | |
| "url":"^http://www\\.hearthpwn\\.com/decks", | |
| "pageElement":"id('decks')/tbody", | |
| "nextLink":"//li[@class='b-pagination-item']/a[(text()='Next')]", | |
| "wedata.net.id":74841 | |
| }, | |
| { | |
| "url":"^http://seiga\\.nicovideo\\.jp/bbs/", | |
| "pageElement":"id(\"theme_bbs_main\")/*", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":30493 | |
| }, | |
| { | |
| "url":"^http://rscolor\\.blog\\.fc2\\.com/", | |
| "pageElement":"//div[@class=\"entry_container\"]", | |
| "nextLink":"//a[contains(text(), \"次のページ\")]", | |
| "wedata.net.id":76484 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?ideaxidea\\.com/", | |
| "pageElement":".//div[@class=\"post\" or @class=\"post_meta\"]", | |
| "nextLink":".//ul[@class=\"page-numbers\"]/li[child::span[contains(@class,\"current\")]]/following-sibling::li[1]/a", | |
| "wedata.net.id":26757 | |
| }, | |
| { | |
| "url":"^http://itpro\\.nikkeibp\\.co\\.jp/", | |
| "insertBefore":"id(\"naviBottom\")", | |
| "pageElement":"id(\"articleBody\")", | |
| "nextLink":"id(\"naviBottom\")//a[@class=\"toNext\"]|id(\"naviBottom\")//a[@class=\"now\"]/following-sibling::a", | |
| "wedata.net.id":2699 | |
| }, | |
| { | |
| "url":"^http://en\\.search\\.pandora\\.tv/", | |
| "pageElement":"id('MvViewDiv')/dl", | |
| "nextLink":"//a[@class='btn_next']", | |
| "wedata.net.id":28935 | |
| }, | |
| { | |
| "url":"^http://(www\\.)?imdb\\.com/.*board", | |
| "pageElement":"//div[@class='thread header']/following-sibling::div|//tr[td/@bgcolor='#006699']/following-sibling::tr|id('lhs')//div[starts-with(@class,'thread mode-')]", | |
| "nextLink":"(//a[@class='current']|//font/b)/following-sibling::a[1]", | |
| "wedata.net.id":65677 | |
| }, | |
| { | |
| "url":"^http://profile\\.hatena\\.ne\\.jp/", | |
| "pageElement":"//ul[@class='fanlist']/li", | |
| "nextLink":"//a[@class='pager-r pager-older']", | |
| "wedata.net.id":27506 | |
| }, | |
| { | |
| "url":"^http://acmlm\\.kafuka\\.org/board/", | |
| "pageElement":"//body/table[tbody/tr/td/@class='nb']/following-sibling::table[@class=\"c1\"]/tbody/tr[not(@class=\"n1\" or @class=\"h\" or @class=\"c\")]", | |
| "nextLink":"//div[@style][./preceding-sibling::table[@class=\"c1\"]]/text()[number(translate(.,\"Pages: \",\"\")) > 0]/following-sibling::a[1]", | |
| "wedata.net.id":74858 | |
| }, | |
| { | |
| "url":"^http://www\\.minecraftforum\\.net/", | |
| "pageElement":"id('posts forum-threads comments')//*[article or td or @class='p-comments p-comments-b']", | |
| "nextLink":"//li[contains(@class,'b-pagination-prev')]/a|//li[span/@class='b-pagination-item s-active active']/following-sibling::li[1]/a", | |
| "wedata.net.id":76344 | |
| }, | |
| { | |
| "url":"^https?://([^/]+\\.)?wikihub\\.io/@", | |
| "pageElement":"//div[@class=\"card\"]|//div[contains(@class,\"card\")][.//div[@class=\"list-group-item media\"]]", | |
| "nextLink":"//*[@class=\"card\"]//a[contains(@class,\"list-group\")][.//i[contains(@class, \"fa-angle-right\")]]", | |
| "wedata.net.id":80868 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?dinos\\.co\\.jp/", | |
| "pageElement":"//ul[@class='lpBlock js_item_list']/li", | |
| "nextLink":"//li[@class='btn next']/a", | |
| "wedata.net.id":53012 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?xkcd\\.com/\\d+/", | |
| "pageElement":"id('comic')/*[self::a or self::img]", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":2726 | |
| }, | |
| { | |
| "url":"^https?://[^.]+\\.craigslist\\.org/", | |
| "pageElement":"//p[@class='row']", | |
| "nextLink":"//a[@class='button next']", | |
| "wedata.net.id":614 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?pornotube\\.com/", | |
| "pageElement":"//div[@class='video_container']//div[@class='video']", | |
| "nextLink":"//div[@class='pagination']//li[span/@class=\"currentpage\"]/following-sibling::li[1]/a", | |
| "wedata.net.id":26716 | |
| }, | |
| { | |
| "url":"^http://www\\.hentai-foundry\\.com/", | |
| "pageElement":"//table[@class=\"galleryViewTable\"]", | |
| "nextLink":"//li[@class=\"next\"]/a", | |
| "wedata.net.id":72770 | |
| }, | |
| { | |
| "url":"^http://tech\\.lampetty\\.net/tech/", | |
| "insertBefore":"id(\"postnavi\")", | |
| "pageElement":"//div[contains(@class,\"post\")]", | |
| "nextLink":"//span[contains(@class,\"older\") or contains(@class,\"next\")]/a", | |
| "wedata.net.id":26709 | |
| }, | |
| { | |
| "url":"^http://jp\\.reuters\\.com/article/", | |
| "pageElement":"id(\"articleText\")", | |
| "nextLink":"//ul/li[@class=\"next\"]/a", | |
| "wedata.net.id":74881 | |
| }, | |
| { | |
| "url":"^http://jibun\\.atmarkit\\.co\\.jp/", | |
| "pageElement":"id('headmenu-area')/following-sibling::*[descendant::*[.='次のページ' or .='前のページ']][1]/following-sibling::*[following-sibling::*/descendant::*[.='次のページ' or .='前のページ']]", | |
| "nextLink":"//a[descendant-or-self::*[contains(., '次のページ')]]", | |
| "wedata.net.id":2053 | |
| }, | |
| { | |
| "url":"^http://www\\.imagebam\\.com/image/", | |
| "pageElement":"id(\"imageContainer\")/table", | |
| "nextLink":"id(\"navigation_bottom\")/a[contains(.,\"next\")]", | |
| "wedata.net.id":66230 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?rutracker\\.org/", | |
| "pageElement":"//table[@class='forumline forum']//tr[@class='hl-tr']|id('topic_main')/tbody[tr/td]|id('tor-tbl')", | |
| "nextLink":"//span[@class=\"pg-jump-menu\"]/following-sibling::b/following-sibling::a[1]", | |
| "wedata.net.id":31619 | |
| }, | |
| { | |
| "url":"^http://www\\.mj-dragon\\.com/blog/", | |
| "pageElement":"//div[@class='post excerpt']|//div[@class='post-single-content box mark-links']/*", | |
| "nextLink":"//li[@class='current']/following-sibling::li[1]/a|//a[@rel='prev']", | |
| "wedata.net.id":72746 | |
| }, | |
| { | |
| "url":"^http://h\\.hatena\\.ne\\.jp/mobile", | |
| "pageElement":"//table[@class='streambody']//tr[not(td/@class='pager')]", | |
| "nextLink":"//a[@accesskey='6']", | |
| "wedata.net.id":55506 | |
| }, | |
| { | |
| "url":"^https?://www\\.flickr\\.com/groups", | |
| "pageElement":"//table[@class=\"with-avatar\"]//tr|//ul[@class=\"topic-list\"]", | |
| "nextLink":"//a[span/@class=\"is-current\"]/following-sibling::a[1]|//a[@class=\"Next rapidnofollow\"]", | |
| "wedata.net.id":53560 | |
| }, | |
| { | |
| "url":"^http://(db|news)\\.netkeiba\\.com/", | |
| "pageElement":"//div[@class='user_review_area fc']|//ul[@class='news_list_ul']/li", | |
| "nextLink":"//div[@class='common_pager']//li[@class='active']/following-sibling::li[1]/a|//a[@title='next page']", | |
| "wedata.net.id":1757 | |
| }, | |
| { | |
| "url":"^http://(?:rula\\.us|sos117\\.com)/", | |
| "pageElement":"id(\"left-col\")/div[contains(concat(\" \", @class, \" \"), \" page-navi \")]/preceding-sibling::div", | |
| "nextLink":"//a[contains(concat(\" \", @class, \" \"), \" next \")]", | |
| "wedata.net.id":53608 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?wordinfo\\.info/", | |
| "pageElement":"id('Words Units')/div", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":31630 | |
| }, | |
| { | |
| "url":"^http://tower\\.jp/(?:article|mag)/", | |
| "pageElement":"//div[ul/@class='pagination']/preceding-sibling::div[starts-with(@class,'inMdl')]", | |
| "nextLink":"//p[@class='nextLink']/a", | |
| "wedata.net.id":76328 | |
| }, | |
| { | |
| "url":"^http://themainstream\\.jugem\\.jp/", | |
| "pageElement":".//node()[@class=\"entry\"]", | |
| "nextLink":".//ul/li[@class=\"next\"]/a", | |
| "wedata.net.id":38758 | |
| }, | |
| { | |
| "url":"^http://allabout\\.co\\.jp/newsdig/", | |
| "pageElement":"//div[@class=\"article-main\"]", | |
| "nextLink":"//a[(text()=\"次のページ >\")]", | |
| "wedata.net.id":77846 | |
| }, | |
| { | |
| "url":"^http://chaoslife\\.findchaos\\.com", | |
| "pageElement":"id(\"comic\")", | |
| "nextLink":"//a[@class=\"navi navi-prev\"]", | |
| "wedata.net.id":77222 | |
| }, | |
| { | |
| "url":"^http://dictionary\\.goo\\.ne\\.jp/", | |
| "pageElement":"//ul[@class='list-search-a']/li", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":28773 | |
| }, | |
| { | |
| "url":"^http://textream\\.yahoo\\.co\\.jp/", | |
| "pageElement":"//ul[@class='commentList']/li", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":584 | |
| }, | |
| { | |
| "url":"^http://www\\.kk-bestsellers\\.com/", | |
| "pageElement":"//img[contains(@src, \"books/img\")]/ancestor::table[3]", | |
| "nextLink":"//a[./img[contains(@src,\"next\")]]", | |
| "wedata.net.id":72742 | |
| }, | |
| { | |
| "url":"^http://textream\\.yahoo\\.co\\.jp/", | |
| "pageElement":"//ul[@class='commentList']/li", | |
| "nextLink":"//li[@class='prev']/a", | |
| "wedata.net.id":77850 | |
| }, | |
| { | |
| "url":"^http://www\\.wired\\.com/category/", | |
| "pageElement":"//section[@class='clearfix site-container']/div/ul/*", | |
| "nextLink":"//a[@class='next page-numbers']", | |
| "wedata.net.id":567 | |
| }, | |
| { | |
| "url":"^http://realtime\\.wsj\\.com/japan/", | |
| "pageElement":"id('excerpts-list')/li|//header[@class='article_header module']|//div[@class='module']", | |
| "nextLink":"id('load_more_div')/a|//a[@class='nav-prevnext nav-prevnext-prev']", | |
| "wedata.net.id":66656 | |
| }, | |
| { | |
| "url":"^http://www\\.kagitaku\\.com/diary/", | |
| "pageElement":"//div[@class='navigation lastChild']/preceding-sibling::*", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":28135 | |
| }, | |
| { | |
| "url":"^http://yanchor\\.blog\\.fc2\\.com/", | |
| "pageElement":"//div[@class=\"ently_outline\"]", | |
| "nextLink":"//link[@rel=\"next\"][count(//div[@class=\"ently_outline\"])>1]|//link[@rel=\"prev\"][count(//div[@class=\"ently_outline\"])=1]", | |
| "wedata.net.id":80884 | |
| }, | |
| { | |
| "url":"^http://www\\.techscore\\.com/tech/", | |
| "pageElement":"//div[@class='main']/div[p]/*[not(@class='page_navi')]", | |
| "nextLink":"//span[@class='next']/a", | |
| "wedata.net.id":544 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?infoworld\\.com/", | |
| "pageElement":"id('drr-container')/*[not(@id='article-top-page-number')]", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":2822 | |
| }, | |
| { | |
| "url":"^http://doujinshi\\.mugimugi\\.org/", | |
| "pageElement":"//div[@class='rounded_box']/div[div/@class='bookinfo']|//table[@class='tablefixing']/tbody/tr", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":26664 | |
| }, | |
| { | |
| "url":"^http://aws\\.amazon\\.com/archives", | |
| "pageElement":"id(\"itemsTable\")", | |
| "nextLink":"//span[@class=\"next\"]/a", | |
| "wedata.net.id":1792 | |
| }, | |
| { | |
| "url":"^http://blog\\.fenrir-inc\\.com/jp/", | |
| "pageElement":"//div[@class='autopagerize_page_element']", | |
| "nextLink":"//a[@class='next page-numbers']", | |
| "wedata.net.id":38126 | |
| }, | |
| { | |
| "url":"^http://www\\.cricketcountry\\.com/", | |
| "pageElement":"//aside[@class='container-left']/section/aside|//section[@class='authors']/section/figure", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":74952 | |
| }, | |
| { | |
| "url":"^http://syosetu\\.com/syuppan/list/", | |
| "pageElement":"id('main')/div[@class='book']", | |
| "nextLink":"//div[@class='naviall']/a[last()][not(./following-sibling::text()[string-length(.)>2])]", | |
| "wedata.net.id":80930 | |
| }, | |
| { | |
| "url":"^https://docs\\.unrealengine\\.com/", | |
| "pageElement":"id(\"maincol\")/*", | |
| "nextLink":"//div[contains(concat(\" \",@class,\" \"),\" next \")]/p/a", | |
| "wedata.net.id":77274 | |
| }, | |
| { | |
| "url":"^http://ryo-ko-pentan\\.jugem\\.jp/", | |
| "pageElement":"//article", | |
| "nextLink":"//span[@class='next mdFontTag mdwf316_8']/a", | |
| "wedata.net.id":37681 | |
| }, | |
| { | |
| "url":"^http://www\\.gpara\\.com/rankings/", | |
| "pageElement":"id('result')//div[a/table]", | |
| "nextLink":"id('result')//span[@class='current']/following-sibling::span/a", | |
| "wedata.net.id":76310 | |
| }, | |
| { | |
| "url":"^http://mixi\\.jp/recent_check\\.pl", | |
| "pageElement":"id(\"bodyMainArea\")/div[@class=\"contentsBody\"]", | |
| "nextLink":"id(\"bodyMainArea\")/div[contains(@class,\"pageNavigation01\")]//ul/li/a[contains(.,\"次\")]", | |
| "wedata.net.id":62558 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?economist\\.com/", | |
| "pageElement":"(id('comments-area')|//div[@class='main-content clearfix section-list'])/article", | |
| "nextLink":"//li[@class='pager-next']/a", | |
| "wedata.net.id":37168 | |
| }, | |
| { | |
| "url":"^http://www\\.yonhapnews\\.co\\.kr/", | |
| "pageElement":"//div[@class='headlines headline-list']/ul/li[div]", | |
| "nextLink":"//a[@class='nextPage']", | |
| "wedata.net.id":54318 | |
| }, | |
| { | |
| "url":"^http://natgeo\\.nikkeibp\\.co\\.jp", | |
| "pageElement":"//div[@class=\"articleInner\"]/*[not(contains(@class,\"PageNav\"))]|//div[@class=\"articleTitleBox\"][//span[@class=\"stay\"]/text()=1]", | |
| "nextLink":"//a[@class=\"nextPage\"]|//div[@id=\"pagePrevNextNavi\"][last()]/a[@class=\"next\"][not(//a[@class=\"nextPage\"])]", | |
| "wedata.net.id":77057 | |
| }, | |
| { | |
| "url":"^http://(en\\.)?rocketnews24\\.com/", | |
| "pageElement":"id(\"main-content\")[not(//link[@rel=\"canonical\"])]/div[starts-with(@id,\"post-\")]/*[not(@class=\"page-links\" or @class=\"post-nav\")]|//div[@class=\"post-content\"][//link[@rel=\"canonical\"]][not(//p[@class=\"page-links\"])]/*[not(@class=\"page-links\" or @class=\"post-nav\")]|//div[@class=\"post-header\"][//link[@rel=\"canonical\"]][not(//p[@class=\"page-links\"])]|//div[contains(@class,\"entry-content\")][//link[@rel=\"canonical\"]][//p[@class=\"page-links\"]]/p[last()]/preceding-sibling::*", | |
| "nextLink":"//a[@class='next' or @rel='prev' or contains(.,'≫')]", | |
| "wedata.net.id":64030 | |
| }, | |
| { | |
| "url":"^http://www\\.suruga-ya\\.jp/search", | |
| "pageElement":"id(\"search_result\")/div", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":63999 | |
| }, | |
| { | |
| "url":"^http://antares1991\\.18pluss\\.ru/", | |
| "pageElement":"//div[@id=\"pun-main\"]", | |
| "nextLink":"//a[(text()=\"»\")]", | |
| "wedata.net.id":77498 | |
| }, | |
| { | |
| "url":"^http://www\\.designntrend\\.com/.+", | |
| "pageElement":"//div[@class='at-list2']", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":77613 | |
| }, | |
| { | |
| "url":"http://ava.pmang.jp/items/receive.*", | |
| "pageElement":"//div[@class='win3']/table", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":80961 | |
| }, | |
| { | |
| "url":"^http://erostagram\\.demouth\\.net/", | |
| "pageElement":"id(\"contents\")/div", | |
| "nextLink":"//div[@class=\"pager\"]/a[.=\"next\"]", | |
| "wedata.net.id":62726 | |
| }, | |
| { | |
| "url":"^http://www\\.webcg\\.net/articles/", | |
| "pageElement":"//div[@class='clear article-inner']", | |
| "nextLink":"//a[@class='next menu-link' ]", | |
| "wedata.net.id":25639 | |
| }, | |
| { | |
| "url":"^http://www\\.footballchannel\\.jp/", | |
| "pageElement":"//div[@id='category_archives' or @class='author_archives_body']/*", | |
| "nextLink":"//a[.='>']", | |
| "wedata.net.id":76255 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?freem\\.ne\\.jp/", | |
| "pageElement":"id(\"categoryList\")/div[starts-with(@class,\"section\")]", | |
| "nextLink":"//a[@class=\"next\"]|//div[@class=\"pager1\"]/text()[number()>0]/following-sibling::a", | |
| "wedata.net.id":32061 | |
| }, | |
| { | |
| "url":"^http://www\\.xda-developers\\.com/", | |
| "pageElement":"//div[@class='col col_12_of_12']", | |
| "nextLink":"//a[@class='next page-numbers']", | |
| "wedata.net.id":33367 | |
| }, | |
| { | |
| "url":"http://search.fenrir-inc.com/\\?.*?", | |
| "pageElement":"//p[@class=\"g\"]/..", | |
| "nextLink":"id(\"nextPageUrl\")", | |
| "wedata.net.id":63015 | |
| }, | |
| { | |
| "url":"^https?://news\\.ycombinator\\.com/", | |
| "pageElement":"//table[@class='itemlist']//tr[@class='morespace']/preceding-sibling::*", | |
| "nextLink":"//a[@class='morelink']", | |
| "wedata.net.id":80970 | |
| }, | |
| { | |
| "url":"^http://e0166\\.blog89\\.fc2\\.com/", | |
| "pageElement":"//div[@class='post']", | |
| "nextLink":"//div[@class='bottom_nav']/p[@class='more-link']/a", | |
| "wedata.net.id":1846 | |
| }, | |
| { | |
| "url":"^http://shopping\\.yahoo\\.co\\.jp/", | |
| "pageElement":"//ol[@class='elLists']/li", | |
| "nextLink":"//div[@class='elNext']/a", | |
| "wedata.net.id":63804 | |
| }, | |
| { | |
| "url":"^http://citronweb\\.net/citronblog/", | |
| "pageElement":"//div[@class=\"entry\"]", | |
| "nextLink":"//a[contains(text(), \"次ページへ\") or @rel=\"prev\"]", | |
| "wedata.net.id":63179 | |
| }, | |
| { | |
| "url":"^http://appgallery\\.appspot\\.com/", | |
| "pageElement":"id(\"searchresults topRated\")/table", | |
| "nextLink":"id(\"pager\")//td[@class=\"selected\"]/following-sibling::td[1]/a|id(\"topRated\")/div/a[contains(text(), \"\u00bb\")]", | |
| "wedata.net.id":35126 | |
| }, | |
| { | |
| "url":"^http://www\\.chibanippo\\.co\\.jp/", | |
| "pageElement":"descendant::div[@class=\"item-list\"][1][not(./preceding-sibling::div)]//li|//table[@class=\"photonews views-table cols-1\"]//tr", | |
| "nextLink":"//li[@class='pager-next']/a", | |
| "wedata.net.id":34894 | |
| }, | |
| { | |
| "url":"^http://hashtagsjp\\.appspot\\.com/", | |
| "pageElement":"//div[@class=\"span7\"]/hr[1]/following-sibling::*[following-sibling::a[@class=\"btn btn-large btn-block btn-primary\"]]", | |
| "nextLink":"//a[@class=\"btn btn-large btn-block btn-primary\"]", | |
| "wedata.net.id":34850 | |
| }, | |
| { | |
| "url":"^http://booklog\\.jp/(ranking|febe)", | |
| "pageElement":"//table[contains(@class,\"tableType2\")]//tr[not(//ul[contains(@class,\"weeklySet\")] or //ul[contains(@class,\"monthlySet\")])]|//div[contains(@class,\"autopagerize_page_element\")][//ul[contains(@class,\"weeklySet\")] or //ul[contains(@class,\"monthlySet\")]]", | |
| "nextLink":"//a[@rel=\"next\"]|//ul[not(@class=\"rankingGenre\")]/li[@class=\"current\"]/preceding-sibling::li[1]/a", | |
| "wedata.net.id":77512 | |
| }, | |
| { | |
| "url":"^http://www\\.smithsonianmag\\.com/", | |
| "pageElement":"//div[@class='article-body pagination-first']/*[not(@class='associated-container')]", | |
| "nextLink":"//a[@class='next pager']", | |
| "wedata.net.id":34845 | |
| }, | |
| { | |
| "url":"^http://[^\\.]+\\.futami\\.co\\.jp/", | |
| "pageElement":"//div[@class='book clear_fix']", | |
| "nextLink":"//div[@class='flow']/ul/li[@class='next']/a|//div[@class='flowNew']/ul/li[@class='prev']/a", | |
| "wedata.net.id":63192 | |
| }, | |
| { | |
| "url":"^http://www\\.shinchosha\\.co\\.jp/", | |
| "pageElement":"//td[table/tbody/tr/td/@class='smp01']/*[tbody/tr/td/@class='smp01' or self::br]|//div[@class='topic_set']", | |
| "nextLink":"//a[contains(.,'>> next') and contains(@href,'?page=') or img[@alt='次のページへ' or contains(@src,'/prev.gif')]]|id('send')/a", | |
| "wedata.net.id":63196 | |
| }, | |
| { | |
| "url":"^http://www\\.toranoana\\.jp/smart/", | |
| "pageElement":"//ul[@class=\"ui-listview\"]", | |
| "nextLink":"//a[contains(concat(\" \",normalize-space(@class),\" \"),\" a_pager_next \")][string-length(@href)>0]", | |
| "wedata.net.id":76236 | |
| }, | |
| { | |
| "url":"^http://www\\.hanselman\\.com/blog/", | |
| "pageElement":"//article", | |
| "nextLink":"//div[@class='paging-prev']/a", | |
| "wedata.net.id":31940 | |
| }, | |
| { | |
| "url":"^http://www.\\afpbb\\.com/articles/", | |
| "pageElement":"(//div|//img)[(@id='NWrelart:Body' and p) or (@id='main-img' and parent::a)]", | |
| "nextLink":"//a[text()='Next >> ' or em[@class='hide-text' and text()='次へ']]", | |
| "wedata.net.id":75012 | |
| }, | |
| { | |
| "url":"^http://www\\.networkworld\\.com/.+", | |
| "pageElement":"//div[@class='river-well article']", | |
| "nextLink":"id('load-more-index')", | |
| "wedata.net.id":33744 | |
| }, | |
| { | |
| "url":"^http://(pret\\.)?yakan-hiko\\.com/", | |
| "pageElement":"//p[img/@class='line_img']/preceding-sibling::*", | |
| "nextLink":"//div[@class='page-numbers']/span[@class='numbers']/following-sibling::a[1]", | |
| "wedata.net.id":63288 | |
| }, | |
| { | |
| "url":"^http://live\\.nicovideo\\.jp/diary", | |
| "pageElement":"//div[@class='kiji']", | |
| "nextLink":"//span[@class='active']/following-sibling::span[1]/a|//div[@class='prev']/a", | |
| "wedata.net.id":55133 | |
| }, | |
| { | |
| "url":"^http://jp\\.forum\\.appbank\\.net/", | |
| "pageElement":"id(\"contents\")/div[contains(@class,\"res-box\")]", | |
| "nextLink":"(//a[descendant::img[@src=\"/images/arrow-r_off.gif\"]])[last()]", | |
| "wedata.net.id":29767 | |
| }, | |
| { | |
| "url":"^http://www\\.tinami\\.com/view/\\d", | |
| "pageElement":"id(\"container\")/*", | |
| "nextLink":"id(\"mv\")/div[last()]/a", | |
| "wedata.net.id":34002 | |
| }, | |
| { | |
| "url":"^http://www\\.car\\.gr/classifieds/", | |
| "pageElement":"id('clist')/div", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":32004 | |
| }, | |
| { | |
| "url":"^http://[^\\.]+\\.kawade\\.co\\.jp/", | |
| "pageElement":"//table[@class='booklistBox']|//div[starts-with(@id,'entry-')]|//div[@class='content'][*[not(@id='trackbacks' or @class='techstuff' or @class='pingsite')]]", | |
| "nextLink":"//a[contains(.,'次へ')]|//link[contains(@rel,'prev')]", | |
| "wedata.net.id":63331 | |
| }, | |
| { | |
| "url":"^http://www\\.1101\\.com/j_diamond/", | |
| "pageElement":"id('wrapper')/table[following-sibling::span/@class='cap']", | |
| "nextLink":"//a[img/@alt='つぎへ']", | |
| "wedata.net.id":67229 | |
| }, | |
| { | |
| "url":"^http://alligator-sunglasses\\.com/", | |
| "pageElement":"//div[@class='blog_main']/*[not(@class='pagination clearfix')]", | |
| "nextLink":"//p[@class='page_right']/a", | |
| "wedata.net.id":34245 | |
| }, | |
| { | |
| "url":"^http://dka-hero\\.com/pict_03/com/", | |
| "pageElement":"//table//tr[not(.//p[@align=\"right\"])]", | |
| "nextLink":"//p[@align=\"right\"]/a", | |
| "wedata.net.id":2797 | |
| }, | |
| { | |
| "url":"^http://tieba\\.baidu\\.com/(p/|f)", | |
| "pageElement":"//div[@class=\"s_post\"]", | |
| "nextLink":"//a[@class=\"next\"]", | |
| "wedata.net.id":26893 | |
| }, | |
| { | |
| "url":"^http://www\\d?\\.e-hon\\.ne\\.jp/", | |
| "pageElement":"//div[(contains(concat(' ', @class, ' '), ' result '))][1]/preceding-sibling::node()[1]/following-sibling::div[@class][(count(//div[@class='reslutPager']) = 1 and self::*) or following::div/@class='reslutPager'][not(starts-with(@class,'result'))] | //td[@width='1']/following-sibling::td[@width='90%']/table | //table[(@width='85%' or @width='86%') and not(descendant::font='▼レビュー数ランキング')]", | |
| "nextLink":"//div[@class='reslutPager']/ul/li[not(a)]/following-sibling::li[1]/a | //a[b[starts-with(normalize-space(.),'次の')]]", | |
| "wedata.net.id":30527 | |
| }, | |
| { | |
| "url":"^http://tegaki\\.pipa\\.jp/techan/", | |
| "pageElement":"//*[@class=\"ThreadDetail\"]", | |
| "nextLink":"//span[@class=\"PageBarItem Selected\"]/following-sibling::a[1]", | |
| "wedata.net.id":26913 | |
| }, | |
| { | |
| "url":"^http://himado\\.in/\\?mode=series", | |
| "insertBefore":"//div[@class='pagenavi']", | |
| "pageElement":"//div[@class='datablock']/table", | |
| "nextLink":"//a[@class=\"pagelink\"]", | |
| "wedata.net.id":67240 | |
| }, | |
| { | |
| "url":"^https?://([^.]+\\.)?reddit\\.com/", | |
| "pageElement":"id(\"siteTable\")/*[not(@class=\"nav-buttons\")]", | |
| "nextLink":"//a[contains(@rel,'next')]", | |
| "wedata.net.id":673 | |
| }, | |
| { | |
| "url":"^http://www\\.minakawa\\.com/blog/", | |
| "pageElement":"//div[@class='article-list hfeed']/*", | |
| "nextLink":"//nav[@class='pagination']/a[last()]", | |
| "wedata.net.id":77652 | |
| }, | |
| { | |
| "url":"^http://www\\.kotaku\\.jp/gallery/", | |
| "pageElement":"//article/img", | |
| "nextLink":"//article/a[@href=//meta[@property=\"og:url\"]/@content]/following-sibling::a[1]", | |
| "wedata.net.id":54727 | |
| }, | |
| { | |
| "url":"^http://(www\\.)?mayoclinic\\.org/", | |
| "pageElement":"//ul[@class='page content']/preceding-sibling::*|//ol[@class='navlist']/li", | |
| "nextLink":"//ul[@class='page content']/li/a[.='Next']|//li[@class='n']/a", | |
| "wedata.net.id":29286 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?419eater\\.com/", | |
| "insertBefore":"//table[@cellpadding=\"30\"]/following-sibling::node()", | |
| "pageElement":"//table[@cellpadding=\"30\"]", | |
| "nextLink":"//a[child::img[contains(@src, \"nxt_page.gif\")]]", | |
| "wedata.net.id":405 | |
| }, | |
| { | |
| "url":"^http://dic\\.nicovideo\\.jp/m/yp/", | |
| "pageElement":"id('main')//div[@class='article']/ul", | |
| "nextLink":"id('main')//div[@class='article']/div[@class='pager']/*[last()][self::a and @class='navi']", | |
| "wedata.net.id":54711 | |
| }, | |
| { | |
| "url":"^http:\\/\\/www.sueddeutsche.de\\/", | |
| "pageElement":"//div[@class='body']/figure/div[@class='content']", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":77243 | |
| }, | |
| { | |
| "url":"^http://imgbbs1\\.artemisweb\\.jp/", | |
| "pageElement":"//center/form/preceding-sibling::table|//center/form/preceding-sibling::table/following-sibling::br[1]", | |
| "nextLink":"//a[.='>>']", | |
| "wedata.net.id":60932 | |
| }, | |
| { | |
| "url":"^http://zarutoro\\.livedoor\\.biz/", | |
| "pageElement":"(//div[@class='article-body entry-content' or @class='article-header']|id('zenback comments-list'))[//ul/@class='article-pager']|//div[@class='article-outer hentry'][//ul/@class='index-navigator']", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":76367 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?alotporn\\.com/", | |
| "pageElement":"//div[@class=\"thumbs\"] | id(\"page\")/descendant::div[contains(concat(\" \", @class, \" \"), \" content \")]/div[contains(concat(\" \", @class, \" \"), \" video \") or contains(concat(\" \", @class, \" \"), \" album \") or contains(concat(\" \", @class, \" \"), \" user \")]", | |
| "nextLink":"//div[contains(concat(\" \", @class, \" \"), \" pagination \")]/ul/li/a[.=\"NEXT\"] | //div[@class=\"pagination\"]/ul/li/span/parent::li/following-sibling::li[1]/a", | |
| "wedata.net.id":55212 | |
| }, | |
| { | |
| "url":"^https?://www\\.animate\\.co\\.jp/", | |
| "pageElement":"//div[@class='thumblist has_border_top']//li", | |
| "nextLink":"//a[@class='nextpostslink']", | |
| "wedata.net.id":79976 | |
| }, | |
| { | |
| "url":"^http://www\\.logsoku\\.com/search", | |
| "pageElement":"id('search_result_threads')//tbody", | |
| "nextLink":"//div[@class='pagination-search']//li[last()]//a[@class='next']", | |
| "wedata.net.id":55217 | |
| }, | |
| { | |
| "url":"^http://www\\.iza\\.ne\\.jp/topics", | |
| "pageElement":"//ul[@class='list-article-01']/li", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":29653 | |
| }, | |
| { | |
| "url":"^http://www\\.vulture\\.com/search", | |
| "pageElement":"//section[@class='search-results']/article", | |
| "nextLink":"//a[@class='next on']", | |
| "wedata.net.id":77664 | |
| }, | |
| { | |
| "url":"^http://plginrt-project\\.com/adb/", | |
| "pageElement":"//div[@class=\"archive-postlist\"]/div", | |
| "nextLink":"//link[@rel='next']", | |
| "wedata.net.id":77180 | |
| }, | |
| { | |
| "url":"^https?://www\\.opera\\.com/blogs/", | |
| "pageElement":"//footer[@class=\"ns--hf\"]/div[1]", | |
| "nextLink":"//ul[@class=\"hf--level-2\"]/li[last()]/a", | |
| "wedata.net.id":77647 | |
| }, | |
| { | |
| "url":"^http://aucfan\\.com/search[12]/s.", | |
| "pageElement":"//div[@class='main']//tr[td/@class='results-price']", | |
| "nextLink":"//span[@class='next']/a", | |
| "wedata.net.id":29323 | |
| }, | |
| { | |
| "url":"^http://(www\\.)?info-fresh\\.com/", | |
| "pageElement":"//table[@class=\"keijibanwaku\"]", | |
| "nextLink":"//td[@class='default']/a[.='>>']", | |
| "wedata.net.id":29276 | |
| }, | |
| { | |
| "url":"^https://comic\\.webnewtype\\.com/", | |
| "pageElement":"//div[@class='row clearfix']", | |
| "nextLink":"//a[@class='ViewerNav-next']", | |
| "wedata.net.id":77673 | |
| }, | |
| { | |
| "url":"^http://[^.]+\\.meiwasuisan\\.com/", | |
| "pageElement":"id('content')/table/tbody/tr[td]", | |
| "nextLink":"//span[@class=\"pagerCurrent\"]/following-sibling::a[1]", | |
| "wedata.net.id":32814 | |
| }, | |
| { | |
| "url":"^http://armorgames\\.com/category/", | |
| "pageElement":"id(\"categorylisting\")/ul[@class=\"gamelisting\"]", | |
| "nextLink":"id(\"categorylisting\")/div[@class=\"pagination\"]/span[@class=\"numberselected\"]/following-sibling::a[1]", | |
| "wedata.net.id":33007 | |
| }, | |
| { | |
| "url":"^http://www\\.kaiseisha\\.co\\.jp/", | |
| "pageElement":"//div[@class='item_wrapper fullwidth' or @class='row clearfix' or @class='article_rowpage_info']", | |
| "nextLink":"//a[@title='次へ' or @class='pagenav next']", | |
| "wedata.net.id":63324 | |
| }, | |
| { | |
| "url":"^http://www\\.discuss\\.com\\.hk/.", | |
| "pageElement":"//ul[contains(@class,'threadlist')]/li", | |
| "nextLink":"//div[contains(@class,'pages')]/strong[last()]/following-sibling::a[1]", | |
| "wedata.net.id":76226 | |
| }, | |
| { | |
| "url":"^http://jobs\\.designcrowd\\.com/.", | |
| "pageElement":"//table[@class='table table-striped']//tr", | |
| "nextLink":"//li[@class='active']/following-sibling::li[1]/a", | |
| "wedata.net.id":80865 | |
| }, | |
| { | |
| "url":"^http://www\\.imdb\\.com/.*reviews", | |
| "pageElement":"id('tn15content')/*[self::hr/following-sibling::div or self::div or self::p[not(a)]]", | |
| "nextLink":"//a[img/@alt='[Next]']", | |
| "wedata.net.id":74723 | |
| }, | |
| { | |
| "url":"^http://jlab\\.fam\\.cx/jlab-start", | |
| "pageElement":"//div[@class=\"pages1\"]/preceding-sibling::*", | |
| "nextLink":"//div[@class=\"pages1\"]/strong/following-sibling::a[1]", | |
| "wedata.net.id":80658 | |
| }, | |
| { | |
| "url":"^http://search\\.diamondblog\\.jp/", | |
| "pageElement":"id('searchResults')/ol/li", | |
| "nextLink":"id('next')/a", | |
| "wedata.net.id":29236 | |
| }, | |
| { | |
| "url":"^http://www\\.ebookjapan\\.jp/ebj/", | |
| "pageElement":"//li[@class='itemList']", | |
| "nextLink":"//a[@class='pager next']", | |
| "wedata.net.id":59846 | |
| }, | |
| { | |
| "url":"^http://www\\.rubyist\\.net/~matz/", | |
| "pageElement":"//div[@class=\"day\" and child::div[@class=\"body\"]]", | |
| "nextLink":"//div[@class=\"adminmenu\"]//a[contains(text(),\"\u524d\")]", | |
| "wedata.net.id":1812 | |
| }, | |
| { | |
| "url":"^http://www\\.famitsu\\.com/cominy", | |
| "pageElement":"//div[@class='parts']/dl", | |
| "nextLink":"//p[@class='prev']/a", | |
| "wedata.net.id":55272 | |
| }, | |
| { | |
| "url":"^http://www\\.nature\\.com/search/", | |
| "pageElement":"//ol[@class='clean-list']/li", | |
| "nextLink":"//a[span/@class='inline-block icon icon-right-small icon-arrow-right-blue']", | |
| "wedata.net.id":30401 | |
| }, | |
| { | |
| "url":"^http://president\\.jp/articles/-/", | |
| "pageElement":"//div[@class=\"article-body\"]/*", | |
| "nextLink":"//div[@class=\"to_next\"]/a", | |
| "wedata.net.id":59677 | |
| }, | |
| { | |
| "url":"^http://.*\\.bilibili\\.com/(all)?", | |
| "pageElement":"//ul[@class='ajax-render']/li", | |
| "nextLink":"//a[@class='nextPage']", | |
| "wedata.net.id":64795 | |
| }, | |
| { | |
| "url":"^http://www\\.theatlantic\\.com/.+", | |
| "pageElement":"//ul[@class='river']/li", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":2542 | |
| }, | |
| { | |
| "url":"^http://www\\.traderjoesfan\\.com/", | |
| "pageElement":"//div[@class='lsrow row-fluid']|//article|//span[@class='row-separator']", | |
| "nextLink":"//li[@class='pagination-next']/a", | |
| "wedata.net.id":29199 | |
| }, | |
| { | |
| "url":"^http://search\\.hatena\\.ne\\.jp/", | |
| "insertBefore":"id(\"hatena-search-pager\")", | |
| "pageElement":"//div[@class=\"hatena-search-result-item\" or @class=\"hatena-search-result-item \" or @class=\"rakuten-item\" or @class=\"video-item-imagelist\"]", | |
| "nextLink":"id(\"hatena-search-pager\")//a[starts-with(text(), \"次\")]", | |
| "wedata.net.id":714 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)goodmanga\\.net/", | |
| "pageElement":"id('manga_viewer')/a", | |
| "nextLink":"id('manga_nav_top')//a[@class='next_page']", | |
| "wedata.net.id":77630 | |
| }, | |
| { | |
| "url":"^http://www\\.eastpress\\.co\\.jp/", | |
| "pageElement":"//td[@bgcolor='#FFFFC5']/*[self::table or self::img] | id('big_hon_shita1')|//article", | |
| "nextLink":"//a[contains(.,'次へ>>') or contains(.,'次のページ')]|//li[@class='active']/following-sibling::li[1]/a", | |
| "wedata.net.id":63201 | |
| }, | |
| { | |
| "url":"^http://www\\.socialitelife\\.com/", | |
| "pageElement":"id('content contentGrid')/div[starts-with(@id,'post-')]", | |
| "nextLink":"//li[@class='next_page']/a", | |
| "wedata.net.id":32606 | |
| }, | |
| { | |
| "url":"^http://www\\.french-movies\\.net/", | |
| "pageElement":"//div[@class='shortstory']", | |
| "nextLink":"//a[i/@class='fa fa-angle-right']", | |
| "wedata.net.id":77364 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?incquity\\.com/", | |
| "pageElement":"id('main')//div[@class='view-content']/*", | |
| "nextLink":"//li[@class='pager-next']/a", | |
| "wedata.net.id":34755 | |
| }, | |
| { | |
| "url":"^https://www\\.caloriecount\\.com/", | |
| "pageElement":"id('searchResultsDiv')//li", | |
| "nextLink":"//span[@class='current']/following-sibling::a[1]", | |
| "wedata.net.id":66811 | |
| }, | |
| { | |
| "url":"^http://(www\\.)?libertyland\\.tv/", | |
| "pageElement":"//div[./h2[@class=\"heading\"]]", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":76954 | |
| }, | |
| { | |
| "url":"^http://happyride\\.se\\.org/forum", | |
| "pageElement":"//table[@class='table forum-table']/tbody/tr|//ul[@class='forum-list']/li", | |
| "nextLink":"//a[i/@class='fa fa-chevron-right']", | |
| "wedata.net.id":77701 | |
| }, | |
| { | |
| "url":"^http://irumahitoma\\.jp/webnovel/", | |
| "pageElement":"//div[@class='noveltext']", | |
| "nextLink":"//div[@class=\"pagenavi\"][1][count(./a)>1 or ./a[@href=\"page02.html\"]]/a[last()]", | |
| "wedata.net.id":57321 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?blognone\\.com/", | |
| "pageElement":"//div[starts-with(@id,'node-')]", | |
| "nextLink":"//li[@class='pager-next']/a", | |
| "wedata.net.id":34828 | |
| }, | |
| { | |
| "url":"^http://www\\.gettinghired\\.com/*", | |
| "pageElement":"//ul[@class=\"job-list-results\"]", | |
| "nextLink":"//a[text()=\"Next Page\"]", | |
| "wedata.net.id":74666 | |
| }, | |
| { | |
| "url":"^http://www\\.silufenia\\.com/cgi/", | |
| "pageElement":"//div[@class='main']/table[.//td/@class='A_TAB'][1]/following-sibling::div[@id='sidemokuji2' or @class='cmain5']|id('read tree article')/*|id('image topic')//tr[td]", | |
| "nextLink":"//td[@class='A_TAB']/a[last()][not(self::a[@href=//td[@class='A_TAB']/a[last()-1]/@href])]|//td[@class='A_TAB'][count(a)=2]/a[1][@href='./index.cgi?log=&page=20']|id('page')/a[contains(@title,'次')]|id('navi')/ul/li[not(a)][last()]/following-sibling::li[1]/a[not(@href='./board.cgi?mode=past')]", | |
| "wedata.net.id":61869 | |
| }, | |
| { | |
| "url":"^http://www\\.photoshoplady\\.com/", | |
| "pageElement":"//div[@class='feature' or @class='tuts']", | |
| "nextLink":"//span[@class='current']/following-sibling::a[1]", | |
| "wedata.net.id":820 | |
| }, | |
| { | |
| "url":"^http://[^.]*\\.stagramaker\\.com/", | |
| "pageElement":"//ul[@class='cf']/li|id('search-result')/tbody/tr[td]", | |
| "nextLink":"id('search-pager')/p/a[contains(.,'>')]|//p[@class='next']/a", | |
| "wedata.net.id":54216 | |
| }, | |
| { | |
| "url":"http://realorgasmlady.dtiblog.com/", | |
| "pageElement":"//div[(@class=\"mainEntryBlock\")]", | |
| "nextLink":"//div[(@class=\"pageLink\")]//a[last()]", | |
| "wedata.net.id":72622 | |
| }, | |
| { | |
| "url":"^http://(www|blog)\\.fooooo\\.com/", | |
| "pageElement":"id('search_result')/* | //div[@class='post_list clearfix']", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":27290 | |
| }, | |
| { | |
| "url":"^http://majo44\\.sakura\\.ne\\.jp/", | |
| "pageElement":"//body/p", | |
| "nextLink":"//a[contains(translate(text(), \"ENTX\", \"entx\"),\"next\")]", | |
| "wedata.net.id":72633 | |
| }, | |
| { | |
| "url":"^http://www\\.gdm\\.or\\.jp/review", | |
| "pageElement":"//div[@class='index_box' or @class='index_title']|//td[@width='485']/table/tbody/tr[@class='hermita_001' or ./following-sibling::tr/@class=\"hermita_001'][position()>1]", | |
| "nextLink":"//a[img/@alt=\"NextPage\"]|//span[@class=\"main_text\"]/a[last()][not(@href=\"#\")]", | |
| "wedata.net.id":33440 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?observer\\.com/", | |
| "pageElement":"//div[@class='entry-content']/p", | |
| "nextLink":"//div[@class='page-links']/text()[number(translate(.,\"Pages: \",\"\")) > 0]/following-sibling::a[1]", | |
| "wedata.net.id":548 | |
| }, | |
| { | |
| "url":"^http://www\\.security-next\\.com/", | |
| "pageElement":"//div[@class='content']/div[@class='title']/following-sibling::*[following::a/descendant::img[@src='/images/sn_p_after.gif' or @src='/images/sn_p_before.gif']]|//div[@class='content']/dl/dd", | |
| "nextLink":"//div[@class='content']//a[descendant::img/@src='/images/sn_p_after.gif']|//a[@rel='next']", | |
| "wedata.net.id":27310 | |
| }, | |
| { | |
| "url":"^http://www\\.vgcats\\.com/comics/", | |
| "pageElement":"//td/div/img[starts-with(@src,\"images/\")]", | |
| "nextLink":"//a[img[@src=\"back.gif\"]]", | |
| "wedata.net.id":76437 | |
| }, | |
| { | |
| "url":"^http://(?:[^.]+\\.)?dlsite\\.com/", | |
| "pageElement":"id(\"search_result_list\")", | |
| "nextLink":"//td[@class=\"page_no\"]/ul/li/a[text()=\"\u6b21\u3078\" or text()=\"Next\"]", | |
| "wedata.net.id":442 | |
| }, | |
| { | |
| "url":"^http://www\\.nextdoordolls\\.com/", | |
| "pageElement":"id('content_thumbs content_display')/*", | |
| "nextLink":"//div[contains(concat(' ', @class, ' '), ' pagination ')]/span[contains(concat(' ', @class, ' '), ' pagerCurrent ')]/following-sibling::a[1]", | |
| "wedata.net.id":62054 | |
| }, | |
| { | |
| "url":"^http://www\\.taikaisyu\\.com/\\d+", | |
| "pageElement":"//h2/a", | |
| "nextLink":"//td//h2/a", | |
| "wedata.net.id":27628 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?carp\\.co\\.jp/", | |
| "pageElement":"id(\"news-contents\") | id(\"right-box\")/table", | |
| "nextLink":"//a[contains(text(), \"\uff1c\uff1c\u524d\u3078\")] | //a[contains(text(), \"<<BACK\")]", | |
| "wedata.net.id":28772 | |
| }, | |
| { | |
| "url":"^http://twitpic\\.com/(?!photos/).", | |
| "pageElement":"id(\"media-main\")/*", | |
| "nextLink":"id(\"neighbor-images\")/a[1]", | |
| "wedata.net.id":29393 | |
| }, | |
| { | |
| "url":"^http://www\\.boxshots\\.org/style", | |
| "pageElement":"//table//tr[td/@class=\"thumb\"]|//table[@style=\"margin-left:auto; margin-right:auto;\"][not(//td[@class=\"thumb\"])]/tbody/tr/td[2]/table[1]//tr[1]/following-sibling::tr", | |
| "nextLink":"//td[@class=\"header\"][(count(./a)=1 and ./a[contains(@href,\"page/1\")]) or count(./a[contains(@href,\"style\")])=2]/a[last()]", | |
| "wedata.net.id":27625 | |
| }, | |
| { | |
| "url":"^http://dic\\.nicovideo\\.jp/revs/", | |
| "pageElement":"//table[@class='revisions']/tbody/tr", | |
| "nextLink":"//div[@class='pager')]/a[starts-with(.,'次')]", | |
| "wedata.net.id":1779 | |
| }, | |
| { | |
| "url":"^http://concreterevolutio\\.com/.+", | |
| "pageElement":"//div[starts-with(@class,'commonList ')]/*[@class='newsBox' or self::hr]|//div[@id='story' and @class='second']/div[@class='commonWidth commonPadding']/*[self::h2 or @class='txt' or @class='img']", | |
| "nextLink":"//div[@class='news_page_next']/a|//a[@class='selected']/following-sibling::a[1]", | |
| "wedata.net.id":77626 | |
| }, | |
| { | |
| "url":"^http://sgrk\\.blog53\\.fc2\\.com/", | |
| "pageElement":"id(\"left\")/*[not(self::a)]", | |
| "nextLink":"id(\"left\")/a[last()][contains(text(), \"\u6b21\")]", | |
| "wedata.net.id":42158 | |
| }, | |
| { | |
| "url":"^http://oresen\\.sakura\\.ne\\.jp/", | |
| "pageElement":"//div[starts-with(@id,'post-')]", | |
| "nextLink":"//div[@class='older']/a", | |
| "wedata.net.id":38269 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?cssmania\\.com/", | |
| "pageElement":"//div[@class='item']", | |
| "nextLink":"//span[@class='current']/following-sibling::a[last()-1]", | |
| "wedata.net.id":870 | |
| }, | |
| { | |
| "url":"^http://www\\.1999\\.co\\.jp/blog/", | |
| "pageElement":"id(\"primary-column\")/div[contains(concat(\" \",@class,\" \"),\" section \")]", | |
| "nextLink":"//td/span[not(a) and number(.) > 0]/following-sibling::span/a", | |
| "wedata.net.id":53763 | |
| }, | |
| { | |
| "url":"^http://(?:[^.]+\\.)*?ganref\\.jp/", | |
| "pageElement":"id('jqTooltip')/li", | |
| "nextLink":"//a[@class='tabNext']", | |
| "wedata.net.id":27619 | |
| }, | |
| { | |
| "url":"^https?://([^/]+\\.)?wikihub\\.io/", | |
| "pageElement":"//a[contains(@class, \"list-group-item\")]|//div[@class=\"row\"]", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":80804 | |
| }, | |
| { | |
| "url":"http://ameblo\\.jp/karin1111karin/", | |
| "pageElement":"(id(\"sub_main\")|id(\"sub_main\")/*)/div[contains(concat(\" \",@class,\" \"), \" entry \") or @id=\"comment_module\" or @id=\"recent_entries_list\" or @id=\"trackback\" or contains(@class,\"trackbackPaging\") or contains(@class,\"commentPaging\")]|//*[article]/*[self::article or self::aside]", | |
| "nextLink":"//a[@amb-component=\"entryPagingPrev\"]", | |
| "wedata.net.id":80692 | |
| }, | |
| { | |
| "url":"^http://gooday\\.nikkei\\.co\\.jp/", | |
| "pageElement":"//div[@class='gdySeriesList typeB']/ul/li|//div[@class='content']", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":76448 | |
| }, | |
| { | |
| "url":"^http://benesse\\.jp/(list|search)", | |
| "pageElement":"//div[@class='single small atc-section']", | |
| "nextLink":"//li[@class='pgn-next']/a", | |
| "wedata.net.id":64395 | |
| }, | |
| { | |
| "url":"^http://www\\.jtnews\\.jp/cgi-bin/", | |
| "pageElement":"//table[@class='REV_MAIN_DATA']//tr", | |
| "nextLink":"//table[@class='BAR_TABLE']/tbody/tr[3]/th/following-sibling::td/a", | |
| "wedata.net.id":65269 | |
| }, | |
| { | |
| "url":"^http://juggly\\.cn/(page/[\\d]+)?", | |
| "pageElement":"id('content')/div[starts-with(@class,'entry entry-')]", | |
| "nextLink":"//a[.='Older »']", | |
| "wedata.net.id":76316 | |
| }, | |
| { | |
| "url":"^http://b\\.hatena\\.ne\\.jp/topic", | |
| "pageElement":"//div[@class='topic-contents js-topic-list']/*", | |
| "nextLink":"//div[@class='pager']/a[contains(.,\"続きを読む\")]", | |
| "wedata.net.id":76901 | |
| }, | |
| { | |
| "url":"^https://chocolatey\\.org/packages", | |
| "pageElement":"id(\"searchResults\")/li", | |
| "nextLink":"//li[@class=\"next\"]/a", | |
| "wedata.net.id":77142 | |
| }, | |
| { | |
| "url":"^http://[^.]+\\.getuploader\\.com/", | |
| "pageElement":"//div[@class=\"table-responsive\"]/table/tbody/tr|//div[@class=\"alert alert-info\"][count(./p)>1]", | |
| "nextLink":"//li[@class=\"next\"][not(./preceding-sibling::li[1][@class=\"active\"])]/a", | |
| "wedata.net.id":29421 | |
| }, | |
| { | |
| "url":"^http://www\\.huffingtonpost\\.jp/", | |
| "pageElement":"//div[starts-with(@id,'entry')]", | |
| "nextLink":"//div[@class='pagination_pager']/div[number()>0]/following-sibling::a[1]", | |
| "wedata.net.id":75006 | |
| }, | |
| { | |
| "url":"^http://books\\.rakuten\\.co\\.jp/", | |
| "pageElement":"//div[@class='item js-item']", | |
| "nextLink":"//a[span/@class='js-disp-num']", | |
| "wedata.net.id":30219 | |
| }, | |
| { | |
| "url":"^http://argyro\\.kakuren-bo\\.com/", | |
| "pageElement":"//div[@class='entrybox'][position()>1]", | |
| "nextLink":"id(\"navi\")//li[last()]/a[not(@href=\"http://argyro.kakuren-bo.com/\")]", | |
| "wedata.net.id":66117 | |
| }, | |
| { | |
| "url":"^http://www\\.section508\\.va.gov/", | |
| "pageElement":"id('content-main')", | |
| "nextLink":"//a[@title='Next']", | |
| "wedata.net.id":77051 | |
| }, | |
| { | |
| "url":"^http://didyouknowblog\\.com/page/", | |
| "pageElement":"//div[@class='content-infinite']/div[@class='content-wrapper']", | |
| "nextLink":"//div[@class='next']/a", | |
| "wedata.net.id":63158 | |
| }, | |
| { | |
| "url":"^http://talkingpointsmemo\\.com/.+", | |
| "pageElement":"//article[@class='row' or contains(@class,'snippet media') or contains(@class,'sponsored-content')]|//ul[@class='tsCollection']/li", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":77603 | |
| }, | |
| { | |
| "url":"^http://climbaz\\.com/chouinard72/", | |
| "insertBefore":"//address", | |
| "pageElement":"//address/preceding-sibling::*", | |
| "nextLink":"//a[contains(text(),\"Next\")][starts-with(@href, \"ch_page\") or starts-with(@href, \"ch_cover\")]", | |
| "wedata.net.id":46137 | |
| }, | |
| { | |
| "url":"^http://www\\.gamesofdesire\\.com/", | |
| "pageElement":"//div[@class=\"maincol\"]", | |
| "nextLink":"//div[@class=\"wp-pagenavi\"]//span[@class=\"current\"]/following-sibling::a[last()]", | |
| "wedata.net.id":80783 | |
| }, | |
| { | |
| "url":"^https://www\\.firefox\\.net\\.cn/", | |
| "pageElement":"id('J_posts_list')/tbody/tr[td/@class='subject']|//div[@class='floor_page']/preceding-sibling::*", | |
| "nextLink":"//a[@class='pages_next J_pages_next']", | |
| "wedata.net.id":65909 | |
| }, | |
| { | |
| "url":"^http://www\\.comiczin\\.jp/diary/", | |
| "pageElement":"id(\"fw_main_contents_area\")/div/div", | |
| "nextLink":"id(\"div_diary_pagenavi_area\")/text()[normalize-space()][string-length()>16 or number()>0]/following-sibling::a", | |
| "wedata.net.id":74958 | |
| }, | |
| { | |
| "url":"^http://netanote\\.shillest\\.net/", | |
| "pageElement":"//table[@class=\"message\"]", | |
| "nextLink":"//table[@class=\"pager\"]/tbody/tr/td/strong/following-sibling::a[1]", | |
| "wedata.net.id":37495 | |
| }, | |
| { | |
| "url":"^http://www\\.isnichwahr\\.de/list", | |
| "pageElement":"//table[@class='table linklist-table']//tr", | |
| "nextLink":"//ul[@class='pagination']/li[@class='next last']/a", | |
| "wedata.net.id":80774 | |
| }, | |
| { | |
| "url":"^http://www\\.thehealthsite\\.com/", | |
| "pageElement":"//figure[@class='h-listing']|//section[@class='inner-box']", | |
| "nextLink":"//a[@class='next page-numbers']|//div[@class='qpages ajax eventtracker']/em/following-sibling::a[1]", | |
| "wedata.net.id":74959 | |
| }, | |
| { | |
| "url":"^http://ugcity\\.pw/forum\\.php\\?", | |
| "pageElement":"id(\"threadlisttableid\")", | |
| "nextLink":"//a[@class=\"nxt\"]", | |
| "wedata.net.id":74404 | |
| }, | |
| { | |
| "url":"http://www\\.alfasystem\\.net/a_m/", | |
| "pageElement":"id(\"diary\")/*", | |
| "nextLink":"id(\"page\")/ul/li/a[text()=\"\u6b21\u306e\u30da\u30fc\u30b8\"]", | |
| "wedata.net.id":32520 | |
| }, | |
| { | |
| "url":"^http://shop\\.zen-on\\.co\\.jp/c/", | |
| "pageElement":"//div[@class='list_item']", | |
| "nextLink":"//a[@class=\"next\"]", | |
| "wedata.net.id":65728 | |
| }, | |
| { | |
| "url":"^http://www\\.superherohype\\.com/", | |
| "pageElement":"//article[@class='clearfix listed-article']|//div[@class='article-content']//td/*", | |
| "nextLink":"//a[@class='nextpostslink']", | |
| "wedata.net.id":74961 | |
| }, | |
| { | |
| "url":"^https://www\\.yify-torrent\\.org/", | |
| "pageElement":"//div[@class='box']/*[@class='mv' or @class='space']", | |
| "nextLink":"//a[@class='current']/following-sibling::a[1]", | |
| "wedata.net.id":77834 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?cepolina\\.com/", | |
| "pageElement":"//div[starts-with(@class,'cep1 ')]", | |
| "nextLink":"//a[.='Next >>']", | |
| "wedata.net.id":26379 | |
| }, | |
| { | |
| "url":"^http://megalodon\\.jp/pc/history/", | |
| "pageElement":"//div[@class='row']/div/p", | |
| "nextLink":"id(\"bgcontain\")/div[@class=\"row\"][2]/div[last()]/a", | |
| "wedata.net.id":26614 | |
| }, | |
| { | |
| "url":"^http://www\\.clustermonkey\\.net/", | |
| "pageElement":"//div[@class='pagination']/preceding-sibling::*", | |
| "nextLink":"//a[@title='Next' or @rel='next']", | |
| "wedata.net.id":2873 | |
| }, | |
| { | |
| "url":"^http://www\\.alexa\\.com/topsites", | |
| "pageElement":"//li[@class='site-listing']", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":73806 | |
| }, | |
| { | |
| "url":"^https://www\\.dropboxforum\\.com/", | |
| "pageElement":"//div[starts-with(@class,'post-overview')]", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":37302 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?alotporn\\.com/", | |
| "pageElement":"//div[contains(concat(\" \", @class, \" \"), \"span-100\")]/div[@class=\"box\"]/div[not(@class=\"btitle\")]rn", | |
| "nextLink":"//a[@class=\"pagination_next\"]", | |
| "wedata.net.id":27509 | |
| }, | |
| { | |
| "url":"^http://nborank\\.agilemedia\\.jp/", | |
| "pageElement":"//div[@class=\"newsSetLarge\"]", | |
| "nextLink":"id(\"toNext\")/a", | |
| "wedata.net.id":77604 | |
| }, | |
| { | |
| "url":"^http://[^.]+\\.momi3\\.net/[^/]+/", | |
| "insertBefore":"//hr/following-sibling::table[@align=\"right\"]", | |
| "pageElement":"//hr/following-sibling::table[@align=\"right\"]/preceding-sibling::node()[not(self::center or self::p or self::hr and @width)]", | |
| "nextLink":"//form[substring(@action, string-length(@action) - string-length(\".htm\") + 1) = \".htm\"][last()]", | |
| "wedata.net.id":32447 | |
| }, | |
| { | |
| "url":"^http://search\\.teglet\\.co\\.jp/", | |
| "pageElement":"id(\"ysp\")", | |
| "nextLink":"//a[@class=\"page\"]", | |
| "wedata.net.id":52539 | |
| }, | |
| { | |
| "url":"^https?://([^.]+\\.)?ioffer\\.com/", | |
| "pageElement":"//div[contains(@class,\"subtle-gallery-item\")]", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":80767 | |
| }, | |
| { | |
| "url":"^http://pickup\\.calamel\\.jp/\\d+", | |
| "pageElement":"//div[contains(./@class , \"entry__body\")]", | |
| "nextLink":"//a[contains(./@class , \"go_next_page\")]", | |
| "wedata.net.id":80701 | |
| }, | |
| { | |
| "url":"^http://www\\.pureoverclock\\.com/", | |
| "pageElement":"id('categorypanels')/div[starts-with(@class,'category')]", | |
| "nextLink":"//link[@rel='next']", | |
| "wedata.net.id":63768 | |
| }, | |
| { | |
| "url":"^http://www\\.trclr\\.com/\\?cat=1", | |
| "pageElement":"id(\"videogallery-list\")", | |
| "nextLink":"id(\"wp_page_numbers\")/ul/li[last()]/a", | |
| "wedata.net.id":52507 | |
| }, | |
| { | |
| "url":"^http://portableapps\\.com/search/", | |
| "pageElement":"//li[@class='search-result']", | |
| "nextLink":"//a[@title='Go to next page']rn", | |
| "wedata.net.id":73822 | |
| }, | |
| { | |
| "url":"^http://blog\\.shueisha\\.co\\.jp/", | |
| "pageElement":"//div[@class=\"dateBox\"]", | |
| "nextLink":"//a[..[@class=\"nextNews\" or @id=\"entryBack\"]]", | |
| "wedata.net.id":65378 | |
| }, | |
| { | |
| "url":"^http://(www\\.)?bananaguide\\.com", | |
| "pageElement":"//div[@id='main']/*[not(@id='pagination')]", | |
| "nextLink":"//div[@id='pagination']/a[text()='NEXT >']", | |
| "wedata.net.id":74356 | |
| }, | |
| { | |
| "url":"^https?://(?:www\\.)?upwork\\.com/", | |
| "pageElement":"//section[@class='air-card-hover']", | |
| "nextLink":"//li[@class='active']/following-sibling::li[1]/a", | |
| "wedata.net.id":62913 | |
| }, | |
| { | |
| "url":"^http://www\\.harborfreight\\.com/", | |
| "pageElement":"//div[@class='category-products']/ul", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":32451 | |
| }, | |
| { | |
| "url":"^http://blog\\.verygoodtown\\.com/", | |
| "pageElement":"id('main')/*[starts-with(@id,'post-') or self::hr]", | |
| "nextLink":"//a[@class='nextpostslink']", | |
| "wedata.net.id":50737 | |
| }, | |
| { | |
| "url":"^http://puyo\\.sega\\.jp/portal/.+", | |
| "pageElement":"//li[starts-with(@class,'blockFallDown')]", | |
| "nextLink":"//a[@class='link_next']", | |
| "wedata.net.id":31597 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)youporn\\.com/.+", | |
| "pageElement":"//*[@id=\"personalizedHomePage\"]|//*[@id=\"content\"]/div[2]", | |
| "nextLink":"//*[@class=\"current\"]/following-sibling::li/a", | |
| "wedata.net.id":77155 | |
| }, | |
| { | |
| "url":"^https://www\\.hdwallpapers\\.net/", | |
| "pageElement":"//div[@class='uk-grid']/div/ul/li[.//img]", | |
| "nextLink":"//li[@class='uk-pagination-next']/a", | |
| "wedata.net.id":32461 | |
| }, | |
| { | |
| "url":"^http://www\\.computerworld\\.com/", | |
| "pageElement":"id('drr-container')", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":28948 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?humorpix\\.com/", | |
| "pageElement":"id(\"Content\")/div[@class=\"media\"]/div[not(@class=\"paginate\")]", | |
| "nextLink":"id(\"Content\")//a[@class=\"next\"]", | |
| "wedata.net.id":27461 | |
| }, | |
| { | |
| "url":"^https://joysound\\.com/web/search", | |
| "pageElement":"id('jp-cmp-main')/section/jp-cmp-song-search-list/div/ul/li", | |
| "nextLink":"//a[contains((.|..)/@class,'jp-cmp-btn-pager-next')]", | |
| "wedata.net.id":47945 | |
| }, | |
| { | |
| "url":"^http://www\\.mymanga\\.me/manga/*", | |
| "pageElement":"//img[@class=\"img-responsive\"]/parent::a", | |
| "nextLink":"//img[@class=\"img-responsive\"]/parent::a", | |
| "wedata.net.id":77607 | |
| }, | |
| { | |
| "url":"^http://www\\.brushking\\.eu/(?!$)", | |
| "pageElement":"//ul[@class='brush-list'][1]/li", | |
| "nextLink":"//span[contains(@class,\"pagi-current\")]/following-sibling::a[1]", | |
| "wedata.net.id":2128 | |
| }, | |
| { | |
| "url":"^http://liontan\\.web\\.fc2\\.com/", | |
| "pageElement":"id(\"contents\")/h3", | |
| "nextLink":"id(\"contents\")//a[contains(.,'ページ目へ')]", | |
| "wedata.net.id":55854 | |
| }, | |
| { | |
| "url":"^http://www\\.realtytoday\\.com/.+", | |
| "pageElement":"//div[@class='sub_box01']", | |
| "nextLink":"id('btn_more')/a|//a[@class='current']/following-sibling::a[1]", | |
| "wedata.net.id":77618 | |
| }, | |
| { | |
| "url":"^http://game\\.ocn\\.ne\\.jp/game/", | |
| "pageElement":"//div[contains(@class,\"gameListWrap\")]", | |
| "nextLink":"//td[@class=\"PageNext\"]/a|//div[@class=\"paging_area\"]//li[./a[@class=\"current\"]]/following-sibling::li[1]/a", | |
| "wedata.net.id":62626 | |
| }, | |
| { | |
| "url":"^https?://(blog\\.)?pinboard\\.in/", | |
| "pageElement":"//div[starts-with(@class,'bookmark ')]|id('blog_content')/*[@class='blog_entry' or self::br]", | |
| "nextLink":"//a[.='« earlier']", | |
| "wedata.net.id":73923 | |
| }, | |
| { | |
| "url":"^http://(?:suche|www)\\.chip\\.de/", | |
| "pageElement":"//*[((self::h1 or self::h2) and @class=\"blueheadline-artikelnavi\") or (self::span and @class=\"general2\")]/../*[not(@class='headline-artikelnavi')]|//article|//div[starts-with(@class,'mi-beitragsliste-download')]", | |
| "nextLink":"//a[@class='forward' or @title='Nächste Seite' or @title='weitere Ergebnisse anzeigen']|//b[@class='selected']/following-sibling::a[1]", | |
| "wedata.net.id":32492 | |
| }, | |
| { | |
| "url":"^http://ndsk\\.net/(?:$|page/\\d+)", | |
| "pageElement":"id(\"content\")", | |
| "nextLink":"//link[@rel=\"next\"]", | |
| "wedata.net.id":55791 | |
| }, | |
| { | |
| "url":"^http://blog\\.osaka-ue\\.ac\\.jp/", | |
| "pageElement":"//div[@class='entry-block']", | |
| "nextLink":"//span[@class='paginate-next']/a", | |
| "wedata.net.id":49845 | |
| }, | |
| { | |
| "url":"^http://www\\.hanmoto\\.com/diary/", | |
| "pageElement":"//div[@class='post']", | |
| "nextLink":"id(\"previousnav\")/a[last()][count(id(\"previousnav\")/a)=4 or number(substring-before(substring-after(id(\"previousnav\")/a[1]/@href,\"page/\"),\"/\"))=2]", | |
| "wedata.net.id":77070 | |
| }, | |
| { | |
| "url":"^http://www\\.fark\\.com/comments/", | |
| "pageElement":"id(\"commentsArea\")", | |
| "nextLink":"id(\"commentsHeader\")/following-sibling::div[1]/strong[./text()][last()]/following-sibling::a[1]", | |
| "wedata.net.id":32482 | |
| }, | |
| { | |
| "url":"^http://[^.]+\\.cnn\\.com/searchrn", | |
| "pageElement":"//article", | |
| "nextLink":"//div[contains(@class,'arrow-right')]/a", | |
| "wedata.net.id":30569 | |
| }, | |
| { | |
| "url":"^https://www\\.shutterstock\\.com/", | |
| "pageElement":"//div[@class='search-content']//li", | |
| "nextLink":"id('mosaic-next-button')", | |
| "wedata.net.id":80965 | |
| }, | |
| { | |
| "url":"^http://video\\.fc2\\.com/a/album*", | |
| "pageElement":"//div[@class=\"pagetitle_under clearfix\"]/following-sibling::div", | |
| "nextLink":"//div[@class='pager_box']/strong/following-sibling::a[1]", | |
| "wedata.net.id":80708 | |
| }, | |
| { | |
| "url":"^http://happism\\.cyzowoman\\.com/", | |
| "pageElement":"id('fortuneEntries listBox')/*", | |
| "nextLink":"//a[@class='link_next']", | |
| "wedata.net.id":73985 | |
| }, | |
| { | |
| "url":"^http://www\\.weddingpark\\.net/.", | |
| "pageElement":"id('result_main')/div[contains(@class,'sbox_pink')]|//ul[@class='placebase_kuchikomi_result']/li|id('SubMainContent')|id('past-left')/div[@class=\"result_cond clearfix\"]/following-sibling::*[following-sibling::div/@class='result_pager clearfix']", | |
| "nextLink":"//p[@class='pager']/text()[contains(.,'~')]/following-sibling::a[1]|//li[@class='next']/a", | |
| "wedata.net.id":30756 | |
| }, | |
| { | |
| "url":"^http://www\\.gospelherald\\.com/", | |
| "pageElement":"id('section-article-list')/div/ul/li", | |
| "nextLink":"//li[span/@class='page current']/following-sibling::li[1]/a", | |
| "wedata.net.id":77147 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?torrents\\.by/", | |
| "pageElement":"id('topic_main tor-tbl forum-table')//tr[td]", | |
| "nextLink":"//a[.='След.']", | |
| "wedata.net.id":49320 | |
| }, | |
| { | |
| "url":"^http://www\\.abbreviations\\.com", | |
| "pageElement":"//tr[td/@class='tal dx']", | |
| "nextLink":"//a[@class='rc5 s']/following-sibling::a[1]", | |
| "wedata.net.id":73956 | |
| }, | |
| { | |
| "url":"^http://forum\\.onliner\\.by/view", | |
| "pageElement":"//ul[@class='b-messages-thread']/li[position()>1][starts-with(@class,'msgpost')] | //div[@class='h-list-subjs']//li", | |
| "nextLink":"//li[@class='page-next']/a", | |
| "wedata.net.id":77213 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?hbe-shop\\.de/", | |
| "pageElement":"//li[@class='list']", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":27467 | |
| }, | |
| { | |
| "url":"^http://marketplace\\.xbox\\.com/", | |
| "pageElement":"//ol[@class='ProductResults GameTiles']/li", | |
| "nextLink":"//a[@class='Next']", | |
| "wedata.net.id":32478 | |
| }, | |
| { | |
| "url":"^http://www\\.sexyandfunny\\.com/", | |
| "pageElement":"//div[@class=\"Date\"]/parent::div[@class=\"content\"]", | |
| "nextLink":"//div[@id=\"paging\"]/a[@class=\"thispage\"]/following-sibling::a", | |
| "wedata.net.id":65542 | |
| }, | |
| { | |
| "url":"^https?://www\\.binsearch\\.info/", | |
| "pageElement":"id('r2')//tr[td]", | |
| "nextLink":"//a[text()='>']", | |
| "wedata.net.id":65555 | |
| }, | |
| { | |
| "url":"^http://www\\.to-ti\\.in/product/", | |
| "pageElement":"//div[@class=\"images\"]", | |
| "nextLink":"//div[@class=\"right\"]/a", | |
| "wedata.net.id":77212 | |
| }, | |
| { | |
| "url":"^http://openlab\\.dino\\.co\\.jp/", | |
| "pageElement":"id(\"content\")/*[not(@class=\"navigation\")]", | |
| "nextLink":"id(\"content\")/div[@class=\"navigation\"]//a[text()=\"\u2190 Previous Entries\"]", | |
| "wedata.net.id":30034 | |
| }, | |
| { | |
| "url":"^http://staff3\\.web\\.fc2\\.com/", | |
| "pageElement":"//p[@style=\"text-align: center; \"]", | |
| "nextLink":"//a[contains(text(),\"next\")]", | |
| "wedata.net.id":62662 | |
| }, | |
| { | |
| "url":"^http://www\\.bijin-snap\\.com/20", | |
| "pageElement":"//div[@class=\"main-image\"][//li[@class=\"prev\"]]/img[@class=\"photo-thumbnail\"]|//div[@class=\"single-section clearfix\"][not(//li[@class=\"prev\"])]", | |
| "nextLink":"//li[@class=\"next\"]/a|//li[@class=\"prev-post\"][not(//li[@class=\"next\"])]/a", | |
| "wedata.net.id":50107 | |
| }, | |
| { | |
| "url":"^http://muumuu\\.com/kaku/fission", | |
| "pageElement":"//table", | |
| "nextLink":"//a[text()=\"\u2192\" or text()=\"\u8aad\u3093\u3067\u307f\u308b\"]", | |
| "wedata.net.id":48204 | |
| }, | |
| { | |
| "url":"^http://eclipsecolorthemes\\.org/", | |
| "pageElement":"//div[@class='listing']/*", | |
| "nextLink":"//div[@class=\"selector\"]/ul[last()]/li[last()]/a[not(@class=\"disabled\")]", | |
| "wedata.net.id":55772 | |
| }, | |
| { | |
| "url":"^http://www\\.tvguide\\.com/news/", | |
| "pageElement":"id('articles')/div[div/p]", | |
| "nextLink":"//a[@class='btn btn-lg btn-show-more']", | |
| "wedata.net.id":77819 | |
| }, | |
| { | |
| "url":"^http://www\\.movieinsider\\.com/", | |
| "pageElement":"//div[@class='panel panel-default has-padding feed-hp' or @class='col-xs-6 col-md-3']|//div[@class='pagination']/following-sibling::*[following-sibling::div/@class='pagination'][not(//div/@class='col-xs-6 col-md-3')]", | |
| "nextLink":"//div[@class='pagination']/strong/following-sibling::a[1]", | |
| "wedata.net.id":80760 | |
| }, | |
| { | |
| "url":"^http://www\\.sbbit\\.jp/article/", | |
| "pageElement":"//div[@class='pragraph']/*[1]/following-sibling::node()[following-sibling::br[last()]]|//div[@class='pragraph']/*[1]", | |
| "nextLink":"//a[contains(.,'次へ')][contains(@href,'?page=')]", | |
| "wedata.net.id":63821 | |
| }, | |
| { | |
| "url":"^http://saya-ichikawa\\.com/blog/", | |
| "pageElement":"id('blogArea')rn", | |
| "nextLink":"//a[@class='nextpostslink']", | |
| "wedata.net.id":76483 | |
| }, | |
| { | |
| "url":"^http://www\\.pcmicrostore\\.com/", | |
| "pageElement":"//table[@class='boxtbl'][.//td/@class='b-parts-list']", | |
| "nextLink":"//span[@class=\"pageract\"]/following-sibling::b[1]/a", | |
| "wedata.net.id":32453 | |
| }, | |
| { | |
| "url":"^http://www\\.rakuten\\.com\\.tw/", | |
| "pageElement":"//ul[@class=\"b-mod-item-list-box\"]", | |
| "nextLink":"//div[@class=\"b-container b-pagination b-center\"]//li[last()]/a", | |
| "wedata.net.id":31289 | |
| }, | |
| { | |
| "url":"^http://freegamejp\\.com/modules/", | |
| "pageElement":"//div[@class='game_category_block']|id('content')//table[@class='color']/ancestor::tr[1]|id('content')/*[(self::div and @class='item') or self::br and not(preceding-sibling::table)]", | |
| "nextLink":"//*[(@class=\"size\" and @align=\"right\") or @style=\"text-align: right; margin: 10px;\"]/b/following-sibling::a[1]", | |
| "wedata.net.id":31599 | |
| }, | |
| { | |
| "url":"^http://up2?\\.pandoravote\\.net/", | |
| "pageElement":"id(\"main page\")/table", | |
| "nextLink":"id(\"main page\")/p/strong/following-sibling::a[1]", | |
| "wedata.net.id":31285 | |
| }, | |
| { | |
| "url":"^http://search\\.4shared\\.com/q/", | |
| "pageElement":"//table[@class=\"listView res_table\"]/tbody/tr", | |
| "nextLink":"//td[@class=\"pagerOn\"]/following-sibling::node()[2]/a", | |
| "wedata.net.id":63089 | |
| }, | |
| { | |
| "url":"^http://wvs\\.topleftpixel\\.com/", | |
| "pageElement":"id(\"fb-root\")/following-sibling::table/tbody/tr[2 < position()]", | |
| "nextLink":"//link[@rel=\"prev\"]", | |
| "wedata.net.id":64141 | |
| }, | |
| { | |
| "url":"^http://www\\.ceskatelevize\\.cz/", | |
| "pageElement":"id(\"discussionModuleComments\")/ul", | |
| "nextLink":"//p[contains(concat(\" \", @class, \" \"), \" paging \")]/strong/following-sibling::a[1]", | |
| "wedata.net.id":55934 | |
| }, | |
| { | |
| "url":"^http://(?:[^./]+\\.)?aukro\\.cz/", | |
| "pageElement":"//section/article", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":55947 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?photos5\\.com/", | |
| "pageElement":"//div[@class='mediaContainer']", | |
| "nextLink":"//div[@class='paging']/a[last()]", | |
| "wedata.net.id":26380 | |
| }, | |
| { | |
| "url":"^http://so\\.bbs\\.runsky\\.com/?", | |
| "pageElement":"id('result-items')//li", | |
| "nextLink":"//a[.='下一页>']", | |
| "wedata.net.id":32443 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?kokugai\\.com/", | |
| "pageElement":"//form[@class=\"itemlist_style\"]", | |
| "nextLink":"//div[@class=\"pagenumber_area clearfix\"]/a[last()]", | |
| "wedata.net.id":29456 | |
| }, | |
| { | |
| "url":"^http://crystal\\.opal\\.ne\\.jp/", | |
| "pageElement":"//table", | |
| "nextLink":"//a[contains(text(),\"\u6b21\u3078\")]", | |
| "wedata.net.id":2208 | |
| }, | |
| { | |
| "url":"^http://pentax\\.mydns\\.jp/exif/", | |
| "pageElement":"//table[3]", | |
| "nextLink":"//a[text()='+']", | |
| "wedata.net.id":2115 | |
| }, | |
| { | |
| "url":"^http://travel\\.yahoo\\.co\\.jp/", | |
| "pageElement":"id('shlist')/li", | |
| "nextLink":"//p[@class='next']/a", | |
| "wedata.net.id":29435 | |
| }, | |
| { | |
| "url":"^http://www\\.elonaup\\.x0\\.com/", | |
| "pageElement":"//table[@summary='upinfo']/tbody/tr[td/a]", | |
| "nextLink":"//hr/following-sibling::text()[contains(., '[')]/following-sibling::a ", | |
| "wedata.net.id":76495 | |
| }, | |
| { | |
| "url":"^http://photozou\\.jp/photo/show/", | |
| "pageElement":"id('media')/*[self::h1 or @class='count_box']|id('photo_area photo_description')", | |
| "nextLink":"//link[@rel='prev']", | |
| "wedata.net.id":26240 | |
| }, | |
| { | |
| "url":"^http://shimoyanagi\\.tblog\\.jp/", | |
| "pageElement":"//div[@class=\"entry_navi\"]/following-sibling::*[not(@class=\"trackback\" or @class=\"entrieBody\")]|//div[@class=\"trackback\"][last()][./following-sibling::div[@class=\"entrieBody\"][./*]]|//div[@class=\"entrieBody\"][not(position()=2)]", | |
| "nextLink":"//div[@class=\"entry_navi\"]/a[1][not(@href=\"./\")]", | |
| "wedata.net.id":53149 | |
| }, | |
| { | |
| "url":"^http://weboo-returns\\.com/blog/", | |
| "pageElement":"//*[contains(@class,'autopagerize_page_element')]", | |
| "nextLink":"//span[@class='page-previous']/a", | |
| "wedata.net.id":35410 | |
| }, | |
| { | |
| "url":"^http://lnm\\.nog\\.jp/list\\.php", | |
| "pageElement":"//article/ul[@class=\"booklist\"]/li[@class='book']", | |
| "nextLink":"//ul/li[@class=\"genzaipage\"]/following-sibling::li/a", | |
| "wedata.net.id":65739 | |
| }, | |
| { | |
| "url":"^http://weekly\\.ascii\\.jp/elem/", | |
| "pageElement":"//div[@class=\"pagination\"]/preceding-sibling::*", | |
| "nextLink":"//div[@class='pagination']//span[@class='active']/following-sibling::span/a", | |
| "wedata.net.id":77217 | |
| }, | |
| { | |
| "url":"^http://www\\.kohnan-eshop\\.com/", | |
| "pageElement":"//div[@class='StyleD_Item_']", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":46240 | |
| }, | |
| { | |
| "url":"^http://www\\.mostinspired\\.com/", | |
| "pageElement":"id('mini')", | |
| "nextLink":"//span[@class='current']/following-sibling::*[1][self::a]", | |
| "wedata.net.id":2077 | |
| }, | |
| { | |
| "url":"^http://www\\.junodownload\\.com/", | |
| "pageElement":"//div[@class='product-list']/div", | |
| "nextLink":"//a[@class='pl_rightarrow']", | |
| "wedata.net.id":28905 | |
| }, | |
| { | |
| "url":"^http://www\\.creativebloq\\.com/", | |
| "pageElement":"id('article-body')/*", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":76886 | |
| }, | |
| { | |
| "url":"^http://dc-trial\\.dengeki\\.com/", | |
| "pageElement":"//center/div/table", | |
| "nextLink":"//a[img[contains(@src, \"arrow_left.png\")]]", | |
| "wedata.net.id":72763 | |
| }, | |
| { | |
| "url":"^http://guide\\.jr-odekake\\.net/", | |
| "pageElement":"//div[@class='areaContents clearfix isotope']", | |
| "nextLink":"//a[img/@alt='つぎへ']", | |
| "wedata.net.id":29532 | |
| }, | |
| { | |
| "url":"^http://www\\.shopbot\\.com\\.au/", | |
| "pageElement":"id('results')/li[not(@class='result next')]", | |
| "nextLink":"//li[@class=\"current\"]/following-sibling::li[1]/a", | |
| "wedata.net.id":77838 | |
| }, | |
| { | |
| "url":"^http://grayscale\\.dou-jin\\.com", | |
| "pageElement":"//div[@class=\"EntryTextBox\"]", | |
| "nextLink":"//li[@class=\"pagelink_10\"][not(./a)]/following-sibling::li[1]/a", | |
| "wedata.net.id":77205 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?kamamoto\\.jp/", | |
| "pageElement":"id('content')/*[@class='item' or self::br]", | |
| "nextLink":"id('content')/div[last()]/b/following-sibling::a[1]", | |
| "wedata.net.id":26644 | |
| }, | |
| { | |
| "url":"^http://www\\.kijineko\\.co\\.jp/", | |
| "pageElement":"id(\"content-inner\")/div", | |
| "nextLink":"//a[@class=\"page-next\"]", | |
| "wedata.net.id":32402 | |
| }, | |
| { | |
| "url":"^http://(www|forum)\\.golem\\.de/", | |
| "pageElement":"//article/*[@class='formatted']|//ol[@class='list-forums' or ../@class='threads']/li", | |
| "nextLink":"id('jtoc_next')|//a[@rel='nofollow next']", | |
| "wedata.net.id":31621 | |
| }, | |
| { | |
| "url":"^http://moegibunko\\.jp/(?!book/)", | |
| "pageElement":"//div[@class='book_title sampleBox' or @class='news_body']", | |
| "nextLink":"//a[@class='next page-numbers']", | |
| "wedata.net.id":77737 | |
| }, | |
| { | |
| "url":"^http://www\\.goal\\.com/jp/news/", | |
| "pageElement":"//div[@id=\"news-archive\"]/*[not(@id=\"pagination\")]", | |
| "nextLink":"//a[@id='next-page']", | |
| "wedata.net.id":66390 | |
| }, | |
| { | |
| "url":"^http://[^/]+\\.shiga-saku\\.net/", | |
| "pageElement":"id(\"content\")/div/*[self::h2 or self::div[@class=\"blogbody\"]]", | |
| "nextLink":"//a[text()=\"\u6b21\u306e\u30da\u30fc\u30b8\" or text()=\"\u524d\u306e\u8a18\u4e8b\"]", | |
| "wedata.net.id":33139 | |
| }, | |
| { | |
| "url":"^http://sitesearch\\.asahi\\.com/", | |
| "pageElement":"id('SiteSearchResult_PR')/li", | |
| "nextLink":"//a[@class='Next']", | |
| "wedata.net.id":53640 | |
| }, | |
| { | |
| "url":"^http://wpb\\.shueisha\\.co\\.jp/", | |
| "pageElement":"//div[@class='mod-article']|//div[@class='mod-articlehead'][not(//div/@class='mod-pagination') or //ul[@class='mod-pagination-pages']/li[1]/span[contains(@class,'current')]]", | |
| "nextLink":"//li[contains(span/@class,'current')]/following-sibling::li/a|//div[@class='area-block-row'][1]/div[@class='area-block-col'][1]//ul[@class='wgt-linklist']/li[1]/a", | |
| "wedata.net.id":65294 | |
| }, | |
| { | |
| "url":"^http://www\\.iknowtoday\\.com/.+", | |
| "pageElement":"//div[@class='thecontent']/*", | |
| "nextLink":"//span[@class='current']/following-sibling::a[1]", | |
| "wedata.net.id":80793 | |
| }, | |
| { | |
| "url":"^http://(.+)/img(.+)?\\.(cgi|htm)", | |
| "pageElement":"//form[@action]/form[@action]/form[@action]|//form[@action]/form[@action][not(./form[@action])]|//center[./form]/following-sibling::form/*[following-sibling::table[.//form]]", | |
| "nextLink":"//table[.//input[contains(@value,'次')]]/following-sibling::b[1]/following-sibling::a[1]|//table[.//input[contains(@value,'削除')]]/following-sibling::node()//b/following-sibling::a[1]", | |
| "wedata.net.id":74574 | |
| }, | |
| { | |
| "url":"^http://iss\\.ndl\\.go\\.jp/books", | |
| "pageElement":"//div[contains(@class,'item_group_wrapper')]", | |
| "nextLink":"id('resultfooter')/ul/li/a[@class='rarrow']", | |
| "wedata.net.id":35244 | |
| }, | |
| { | |
| "url":"^http://mixi\\.jp/list_voice\\.pl", | |
| "pageElement":"id(\"bodyMainArea\")/div/ul", | |
| "nextLink":"id(\"bodyMainArea\")/div/div/div[@class=\"pageList02\"]/ul/li[last()]/a[text()=\"次を表示\"]", | |
| "wedata.net.id":45564 | |
| }, | |
| { | |
| "url":"^http://ncore\\.cc/torrents\\.php", | |
| "pageElement":"/html/body/div[2]/div/div/div[5]/div/div/div[4]", | |
| "nextLink":"/html/body/div[2]/div/div/div[5]/div/div/div[6]/div[5]/div/a[1]", | |
| "wedata.net.id":56777 | |
| }, | |
| { | |
| "url":"^http://www\\.gentosha\\.co\\.jp/", | |
| "pageElement":"//div[contains(concat(\" \", @class, \" \"), \" result \")]//div[contains(concat(\" \", @class, \" \"), \" block \")] | //ul[@class=\"newsList\"]", | |
| "nextLink":"id(\"next\")/a", | |
| "wedata.net.id":63176 | |
| }, | |
| { | |
| "url":"^http://www\\.geekpage\\.jp/blog/", | |
| "pageElement":"//div[@class=\"main\"]/*[following-sibling::div[@class=\"blogpagenavi\"]]", | |
| "nextLink":"//div[@class=\"main\"]/div[@class=\"blogpagenavi\"]/ul/li[last()]/a", | |
| "wedata.net.id":45550 | |
| }, | |
| { | |
| "url":"^http://search\\.biccamera\\.com/", | |
| "pageElement":"//div[@class='sp_padding']/form/ul/li", | |
| "nextLink":"//p[@class='next']/a", | |
| "wedata.net.id":28890 | |
| }, | |
| { | |
| "url":"^http://www\\.nikkeibp\\.co\\.jp/", | |
| "pageElement":"//div[@class='rensai_kiji']|//div[@class='headlines']//li", | |
| "nextLink":"//a[(.|..)/@class='next']", | |
| "wedata.net.id":76442 | |
| }, | |
| { | |
| "url":"^https?://www\\.ark-pc\\.co\\.jp/", | |
| "pageElement":"//tr[./td[@class=\"hline\"]]", | |
| "nextLink":"id(\"listnavi_next\")/a", | |
| "wedata.net.id":64490 | |
| }, | |
| { | |
| "url":"^http://www\\.myopenrouter\\.com/", | |
| "pageElement":"//div[@class='view-content']/*[not(//li/@class='search-result' or id('forum-topic-list') or //table/@class='views-table cols-4')]|//li[@class='search-result']|(id('forum-topic-list')/table|//table[@class='views-table cols-4'])/tbody/tr[td]|id('forum-comments')/*|//div[@class='block-content clearfix']/div[starts-with(@id,'article-')]", | |
| "nextLink":"//a[@title='Go to next page']", | |
| "wedata.net.id":76503 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?lingoes\\.net/", | |
| "pageElement":"//td[contains(text(), 'Page') and contains(text(), 'of')]/ancestor::table[1]/following-sibling::*[following::table[descendant::td[contains(text(), 'Page') and contains(text(), 'of')]]]", | |
| "nextLink":"//td[contains(text(), 'Page') and contains(text(), 'of')]//a[preceding-sibling::*[descendant::b]][1]", | |
| "wedata.net.id":27623 | |
| }, | |
| { | |
| "url":"^http://www\\.irishcentral\\.com/", | |
| "pageElement":"//div[@class='content-holder article-holder']/*[not(@class='img-box main-article-image-box')]|id('stories-holder')/article", | |
| "nextLink":"//li[@class='active']/following-sibling::li[1]/a|//a[@rel='next']", | |
| "wedata.net.id":35144 | |
| }, | |
| { | |
| "url":"^http://k2b-bulk\\.ebay\\.com/ws/", | |
| "pageElement":"//tbody[@class=\"dt-rs dt-cs\"]", | |
| "nextLink":"//a[@title=\"Next page\"]", | |
| "wedata.net.id":77849 | |
| }, | |
| { | |
| "url":"^http://.+\\.pconline\\.com\\.cn/", | |
| "pageElement":"//div[@class='art-bd content' or @class='art' or @class='picMain']|//div[@class='art_bd']/div[@class='content']|//div[@class='border_c1_in cbox_art box758']/*[preceding-sibling::p/@class='center red2'][following-sibling::div/@class='pconline_page']|id('Jfloorlist JLazyList Jproduct-list')/*|id('JCmtImg')//td/*", | |
| "nextLink":"//a[@class='next']|//ul[not(@class='nav')]/li[@class='cur']/following-sibling::li/a|//div[@class='pager']/span[1]/following-sibling::a[1]|//ul[@class='f16']//li[last()]/b/a", | |
| "wedata.net.id":76780 | |
| }, | |
| { | |
| "url":"^http://(www\\.)?userlogos\\.org/", | |
| "pageElement":"//div[@class='view-content']/div[starts-with(@class,'views-row')]|id('forum')//*[td or starts-with(@class,'comment comment')]|//div[@id='comments']/div[starts-with(@class,'comment')]", | |
| "nextLink":"//li[@class='pager-next']/a", | |
| "wedata.net.id":32551 | |
| }, | |
| { | |
| "url":"^https://musicbrainz\\.org/search", | |
| "pageElement":"//table[@class='tbl']/tbody/tr", | |
| "nextLink":"//ul[@class='pagination']/li[last()]/a", | |
| "wedata.net.id":29109 | |
| }, | |
| { | |
| "url":"^http://[^.]+\\.deviantart\\.com/", | |
| "pageElement":"id('gmi-CCommentThread')/*[not(//div/@class='browse-results-page' or //div[starts-with(@class,'tt-a tt-fh')])]|id('groupsContent')/*|//div[starts-with(@class,'tt-a tt-fh') or starts-with(@class,'tt-a tt-special')]", | |
| "nextLink":"//*[@class='next' or @class='pagination']/a", | |
| "wedata.net.id":446 | |
| }, | |
| { | |
| "url":"^http://www\\.sho-comi\\.com/news", | |
| "pageElement":"//div[@class='tab_contents clearfix']", | |
| "nextLink":"//ul[@class='paging']/a[@class='link_next']", | |
| "wedata.net.id":66793 | |
| }, | |
| { | |
| "url":"^https://garrysmods\\.org/browse/", | |
| "pageElement":"//div[@class=\"four columns end\"]", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":32552 | |
| }, | |
| { | |
| "url":"^http://labs\\.ceek\\.jp/hbnews/.", | |
| "insertBefore":"//h3[@class=\"main-navi\"]", | |
| "pageElement":"//div[@class=\"entry\"][position()!=1]", | |
| "nextLink":"//h3[@class=\"main-navi\"]/a[last()]", | |
| "wedata.net.id":834 | |
| }, | |
| { | |
| "url":"^http://www\\.metacritic\\.com/.+", | |
| "pageElement":"id('main')//div[@class='body']//*[contains(@class,'list_products') or @class='search_results module' or starts-with(@class,'reviews')]/li|//div[@class='product_rows']/div", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":76441 | |
| }, | |
| { | |
| "url":"^http://videos\\.yizhansou\\.com/", | |
| "pageElement":"//tr[td[contains(concat(\" \", @class, \" \"), \" xt \")]]", | |
| "nextLink":"//li[contains(concat(\" \", @class, \" \"), \" next \")]/a", | |
| "wedata.net.id":55377 | |
| }, | |
| { | |
| "url":"^https?://([^/]+\\.)?cinra\\.net/", | |
| "pageElement":"//ul[@class='newsList']/li|//div[@class='l-wysiwyg mt']/*[not(@class='titleListBox')]|//div[@class='inner']/*[not(@class='nextBox')]|//section[@class='l-wysiwyg']/*[not(@class='article-nextPage')]|//ul[@class=\"articleList-largeList\"]|//div[@class=\"l-panel\"]", | |
| "nextLink":"//a[@class='pagination-next button-default']|//*[@class=\"article-next\" or @class='txtNext' or @class='nextBox']/a", | |
| "wedata.net.id":2439 | |
| }, | |
| { | |
| "url":"^http://.+\\.bloguru\\.com/[^/]+/", | |
| "pageElement":"//div[@class='post']", | |
| "nextLink":"//li[@class='active']/following-sibling::li[1]/a", | |
| "wedata.net.id":38428 | |
| }, | |
| { | |
| "url":"^http://www\\.freeimages\\.com/.+", | |
| "pageElement":"//div[@class='search-thumb' or @class='listing-main']/ul/li", | |
| "nextLink":"//a[.='Next >']", | |
| "wedata.net.id":541 | |
| }, | |
| { | |
| "url":"^http://www\\.channel24\\.co\\.za", | |
| "pageElement":"//div[@class='article_listings col620']/*[preceding-sibling::div[@class='spacer clr'][1]][following-sibling::div[@class='greyline clr'][last()]]", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":77226 | |
| }, | |
| { | |
| "url":"^http://xyzzy-022\\.github\\.com/", | |
| "pageElement":"//div[@class='prev-next']/preceding-sibling::*", | |
| "nextLink":"//a[@class='prev']", | |
| "wedata.net.id":63651 | |
| }, | |
| { | |
| "url":"^http://ci\\.nii\\.ac\\.jp/search", | |
| "pageElement":"//form[@name=\"articlelist\"]", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":29118 | |
| }, | |
| { | |
| "url":"^http://novel\\.munpia\\.com/page", | |
| "pageElement":"//div[@class='article']", | |
| "nextLink":"//ul[@class='paging zoom']/li[a/@class='on']/following-sibling::li[1]/a", | |
| "wedata.net.id":54200 | |
| }, | |
| { | |
| "url":"^https://www\\.lushstories\\.com/", | |
| "pageElement":"id('content searchresults')/div[starts-with(@class,'entry')]", | |
| "nextLink":"//a[@title='Go to next page']", | |
| "wedata.net.id":62048 | |
| }, | |
| { | |
| "url":"^https?://(?:www\\.)?vimeo\\.com/", | |
| "pageElement":"id('browse_content')/ol/li", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":561 | |
| }, | |
| { | |
| "url":"^http://www\\.tv-tokyo\\.co\\.jp/", | |
| "pageElement":"id('content_r')/div[contains(@class,'entry')]|id('txdouga_resultList')//li", | |
| "nextLink":"id('epinav')/span/following-sibling::a|//a[@rel='next']", | |
| "wedata.net.id":76647 | |
| }, | |
| { | |
| "url":"^http://[^./]+\\.softpedia\\.com/", | |
| "pageElement":"//div[starts-with(@class,'grid_48 dlcls dlcls')]", | |
| "nextLink":"//a[@title='Next page']", | |
| "wedata.net.id":30262 | |
| }, | |
| { | |
| "url":"^http://www\\.bikebros\\.co\\.jp/", | |
| "pageElement":"//div[@class=\"impreboxlist\"]|id(\"twobox\")/div[@class=\"modelreview_detail\"][./following-sibling::div[@class=\"modelreview_detail\"]]|id(\"rightbox300\")[not(./preceding-sibling::div[@id=\"twobox\"])]/preceding-sibling::*|id(\"twobox\")/div[@class=\"modelreview_detail\"][last()][not(./div[@id=\"rightbox\"])]|//ul[@class=\"display\"]/li", | |
| "nextLink":"//a[@title=\"next page\"]|//span[@class=\"current\"]/following-sibling::a[1]", | |
| "wedata.net.id":80880 | |
| }, | |
| { | |
| "url":"^http://www\\.chosunonline\\.com/", | |
| "pageElement":"//ul[@class='list_article']|//dl[@class='search_article']", | |
| "nextLink":"//div[@class='list_page']/b/following-sibling::a[1]", | |
| "wedata.net.id":30282 | |
| }, | |
| { | |
| "url":"^http://.+talk\\.nbcsports\\.com/", | |
| "pageElement":"//div[starts-with(@id,'post-')]", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":77457 | |
| }, | |
| { | |
| "url":"^http://www\\.kasakura\\.co\\.jp/", | |
| "pageElement":"//div[@class='short_cnt_box']|id('list_box')/li", | |
| "nextLink":"//div[contains(@class,'tracker')][not(.//text()[normalize-space()='次へ'])]/text()[translate(normalize-space(),'・[]','')]/following-sibling::a[1]|//a[normalize-space()='次へ' or ../@class='page_index' and contains(.,'次のページ')]", | |
| "wedata.net.id":63187 | |
| }, | |
| { | |
| "url":"^http://bl\\.takeshobo\\.co\\.jp/", | |
| "pageElement":"//div[@class='comicList bd-line' or @class='article']", | |
| "nextLink":"//a[contains(concat(\" \", @class, \" \"), \"next\")] | //link[@rel=\"prev\" and contains(@href, \"-report/\")]", | |
| "wedata.net.id":63648 | |
| }, | |
| { | |
| "url":"^http://www\\.guardian\\.co\\.uk/", | |
| "pageElement":"//div[@class='index-page-header' and div/@class='index-page-header__content']/following-sibling::*[following-sibling::div/@class='fc-container__pagination']", | |
| "nextLink":"//ul[contains(concat(' ', @class, ' '), ' pagination ')]/li[not(a)]/following-sibling::li[1]/a", | |
| "wedata.net.id":66806 | |
| }, | |
| { | |
| "url":"^http://www\\.tokyo-source\\.com/", | |
| "pageElement":"//ul[@class=\"list\"]/li|id(\"main\")/div[@class=\"content\"]/*[not(@class=\"social\" or @class=\"pager\")]|id(\"title\")|id(\"main\")/div[@class=\"img-main\"]", | |
| "nextLink":"//*[@class='pager']/a[@class='next' or contains(img/@src,'second')]|//div[@class='latest']//h4/a[contains(@href,number(id('title')//p[@class='number'])-1)]", | |
| "wedata.net.id":61850 | |
| }, | |
| { | |
| "url":"http://tieba\\.baidu\\.com/f\\?.+", | |
| "insertBefore":"//div[@class='foot']", | |
| "pageElement":"//ul[@id=\"thread_list\"]/li[contains(@class, 'j_thread_list')]", | |
| "nextLink":"//*[@id=\"frs_list_pager\"]/a[starts-with(text(), '下一页')]", | |
| "wedata.net.id":80980 | |
| }, | |
| { | |
| "url":"^http://www\\.sixapart\\.jp/news/", | |
| "pageElement":"id(\"entrylist\")//*[self::dt or self::dd]", | |
| "nextLink":"//li[@class=\"next\"]/a", | |
| "wedata.net.id":2489 | |
| }, | |
| { | |
| "url":"^http://www\\.window7theme\\.com/", | |
| "pageElement":"id(\"aligner\")", | |
| "nextLink":"//a[@class=\"nextpostslink\"]", | |
| "wedata.net.id":64911 | |
| }, | |
| { | |
| "url":"^http://mixi\\.jp/list_diary\\.pl", | |
| "pageElement":"(id(\"bodyMainAreaMain\")|id(\"bodyMainAreaMain\")/form)/node()[self::div[contains(@class,\"listDiaryBlock\")] or not(*)]", | |
| "nextLink":"//li[@rel=\"__next\"]/a", | |
| "wedata.net.id":64855 | |
| }, | |
| { | |
| "url":"^http://no-ichigo\\.jp/read/page/", | |
| "pageElement":"//div[@id='content-mailcol']", | |
| "nextLink":"//a[contains(text(), \"次へ\")]", | |
| "wedata.net.id":80982 | |
| }, | |
| { | |
| "url":"^http://www\\.czechcasting\\.com/", | |
| "pageElement":"//div[@class=\"console inner tour pagebar\"]/following-sibling::*[following::div[@class=\"bonussites\"]]", | |
| "nextLink":"//a[@class=\"arrow-right\"]", | |
| "wedata.net.id":77700 | |
| }, | |
| { | |
| "url":"^http://dic\\.nicovideo\\.jp/b/c/", | |
| "pageElement":"//dl", | |
| "nextLink":"//div[contains(concat(\" \", @class, \" \"), \" pager \")]/a[starts-with(text(), \"次\")]", | |
| "wedata.net.id":1992 | |
| }, | |
| { | |
| "url":"^http://woman\\.excite\\.co\\.jp/", | |
| "pageElement":"id('article_story')/node()|//ul[@class='simplelist articleList'][1]/li[not(id('article_story'))]", | |
| "nextLink":"//a[contains(.,'次のページへ>') or @title='次のページへ']", | |
| "wedata.net.id":72598 | |
| }, | |
| { | |
| "url":"^http://www\\.iza\\.ne\\.jp/kiji/", | |
| "pageElement":"//section[@class=\"news-category-section\"]/ul", | |
| "nextLink":"//a[@class=\"next\"]", | |
| "wedata.net.id":733 | |
| }, | |
| { | |
| "url":"^http://www\\.mapion\\.co\\.jp/s/", | |
| "pageElement":"//ul[@class=\"pager\"][1]/following-sibling::div//li|(id(\"NumberSection\")|//div[@class=\"section event\"])/dl", | |
| "nextLink":"//ul[@class=\"pager\"]/li[last()][not(./following-sibling::span)]/a", | |
| "wedata.net.id":64677 | |
| }, | |
| { | |
| "url":"^https://www\\.warsow\\.gg/forum/", | |
| "pageElement":"//div[@class='tbl-tbody']/div", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":27199 | |
| }, | |
| { | |
| "url":"^http://www\\.s-book\\.net/plsql/", | |
| "pageElement":"//tr[td/@bgcolor='#ffcc66']/following-sibling::tr", | |
| "nextLink":"//a[contains(.,'次の') and contains(@href, '&page=')]", | |
| "wedata.net.id":63203 | |
| }, | |
| { | |
| "url":"^https://(?:[^/]+\\.)?booth\\.pm/", | |
| "pageElement":"//ul[@class='market-items' or @class='item-list']/li", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":76408 | |
| }, | |
| { | |
| "url":"^http://www\\.selectsquare\\.com/", | |
| "pageElement":"//ul[@class=\"list_box list_box3\"]/li", | |
| "nextLink":"//li[@class=\"next\"]/a", | |
| "wedata.net.id":722 | |
| }, | |
| { | |
| "url":"^http://(?:[^.]+\\.)*?xnxx\\.com/", | |
| "pageElement":"//table[@cellspacing=\"0\"][@cellpadding=\"2\"]", | |
| "nextLink":"//a[@class=\"nP\"]", | |
| "wedata.net.id":29194 | |
| }, | |
| { | |
| "url":"^http:\\/\\/cyberillusions.com\\/", | |
| "pageElement":"div[@class=\\\"g-album-grid-container\\\"]", | |
| "nextLink":"a[@id=\\\"g-navi-next\\\" and last()]", | |
| "wedata.net.id":72580 | |
| }, | |
| { | |
| "url":"^http://counting\\.hatelabo\\.jp/", | |
| "pageElement":"id(\"body\")/ul", | |
| "nextLink":"id(\"body\")/div[@class=\"pager\"]/div[@class=\"pager-next\"]/a", | |
| "wedata.net.id":25963 | |
| }, | |
| { | |
| "url":"^http://rapeme\\.org/mt/archives/", | |
| "pageElement":"//h1 | //div[contains(concat(\" \",normalize-space(@class),\" \"),\" entry \")]", | |
| "nextLink":"//li[@class=\"older\"]/a", | |
| "wedata.net.id":32102 | |
| }, | |
| { | |
| "url":"^http://news\\.biglobe\\.ne\\.jp/", | |
| "pageElement":"//div[@class='pgingNav clearfix']/preceding-sibling::*[1]//li", | |
| "nextLink":"//a[@title='次の10件']", | |
| "wedata.net.id":33051 | |
| }, | |
| { | |
| "url":"^https?://oshiete\\.goo\\.ne\\.jp", | |
| "pageElement":"//div[@class='r_list']//li[@class='clearfix']", | |
| "nextLink":"id('paging')/span[@class='cur']/following-sibling::span[1]/a", | |
| "wedata.net.id":77017 | |
| }, | |
| { | |
| "url":"^https://healthengine\\.com\\.au/", | |
| "pageElement":"//div[@class='clearfix he-listing']", | |
| "nextLink":"//a[i/@class='fui-arrow-right']", | |
| "wedata.net.id":76740 | |
| }, | |
| { | |
| "url":"^http://mixi\\.jp/view_album\\.pl", | |
| "insertBefore":"id(\"view_photo\")/div[@class=\"pagetext_bottom inlineList\"]", | |
| "pageElement":"id(\"view_photo\")/div[@class=\"inner_line_list\"]", | |
| "nextLink":"//a[starts-with(text(), \"\u6b21\u3092\")]", | |
| "wedata.net.id":603 | |
| }, | |
| { | |
| "url":"^http://news\\.mynavi\\.jp/photo/", | |
| "pageElement":"id('photo-pane')|//div[@class='lead']", | |
| "nextLink":"//a[./div[@class='button button-next']]", | |
| "wedata.net.id":27050 | |
| }, | |
| { | |
| "url":"^http://mixi\\.jp/view_diary\\.pl", | |
| "insertBefore":"id(\"bodyMainAreaMain\")/node()[last()]", | |
| "pageElement":"id(\"bodyMainAreaMain\")/div[@class=\"viewDiaryBox\"]|id(\"diaryComment\")", | |
| "nextLink":"id(\"bodyMainAreaMain\")/div[contains(concat(\" \", @class, \" \"), \" diaryPaging01 \")]/div[@class=\"diaryPagingRight\"]/a", | |
| "wedata.net.id":605 | |
| }, | |
| { | |
| "url":"^http://www\\.proskit\\.com\\.tw/", | |
| "pageElement":"//div[@class='row Products_Info']/*", | |
| "nextLink":"//li[@class='active']/following-sibling::li[1]/a", | |
| "wedata.net.id":76739 | |
| }, | |
| { | |
| "url":"^https://www\\.moshimo\\.com/shop", | |
| "insertBefore":"id(\"container\")/div[@class=\"basic\"]/div[@class=\"footer block-center\"]", | |
| "pageElement":"id(\"search-item-body\")", | |
| "nextLink":"id(\"search-item-body\")/div[@class=\"bottom-pager inline-center\"]/div[@class=\"pager\"]/a[number(last())-1]", | |
| "wedata.net.id":27687 | |
| }, | |
| { | |
| "url":"^http://freeware\\.easylife\\.tw/", | |
| "pageElement":"id(\"content\")/div[@class=\"hfeed\"]/div[@class=\"hentry\"]", | |
| "nextLink":"id(\"pager\")/a[last()]", | |
| "wedata.net.id":74701 | |
| }, | |
| { | |
| "url":"^http://extrafabulouscomics\\.com", | |
| "pageElement":"id(\"comic\")/*[self::img or self::a or self::iframe]", | |
| "nextLink":"//a[@title=\"PREV\"]", | |
| "wedata.net.id":77641 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?2chnavi\\.net/", | |
| "pageElement":"//table[@class='entrylist']//tr", | |
| "nextLink":"//div[@class='paging']/span/following-sibling::a[1]", | |
| "wedata.net.id":39013 | |
| }, | |
| { | |
| "url":"^http://dengekionline\\.com/elem/", | |
| "pageElement":"id(\"contArt\")/*[following-sibling::div[@class=\"pager\"]]", | |
| "nextLink":"//a[@class=\"next\"]", | |
| "wedata.net.id":25720 | |
| }, | |
| { | |
| "url":"^http://www\\.sfgate\\.com/search", | |
| "pageElement":"//div[@class='gsa-search-results clearfix']/div[starts-with(@class,'gsa-item')]", | |
| "nextLink":"//span[@class='selected']/following-sibling::a[1]", | |
| "wedata.net.id":33016 | |
| }, | |
| { | |
| "url":"^http://www\\.rakuteneagles\\.jp/", | |
| "pageElement":"id(\"calendar\")/*", | |
| "nextLink":"//div[contains(concat(\" \", @class, \" \"), \" selectMonth01 \")]/a[contains(concat(\" \", @class, \" \"), \" next01 \")]", | |
| "wedata.net.id":59847 | |
| }, | |
| { | |
| "url":"^http://creatalk\\.com/interview/", | |
| "pageElement":"id(\"area-main\")//div[@class=\"block plain framed\"][1]//div[@class=\"column set-1\"]", | |
| "nextLink":"//span[@class='bdnavi-numbers']/a[contains(.,number(//span[@class='bdnavi-numbers']/text())+1)]", | |
| "wedata.net.id":63854 | |
| }, | |
| { | |
| "url":"^http://diskunion\\.net/clubt/ct/", | |
| "pageElement":"//ul[@class='dataBox clearfix']", | |
| "nextLink":"//a[contains(span,'次の')]", | |
| "wedata.net.id":27012 | |
| }, | |
| { | |
| "url":"^https://www\\.renderosity\\.com/", | |
| "pageElement":"id('tiles')/li", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":27771 | |
| }, | |
| { | |
| "url":"^http://www\\.jstor\\.org/stable/", | |
| "pageElement":"//div[@class='article-view small-12 columns brandingStripe']", | |
| "nextLink":"//a[@class='next-item']", | |
| "wedata.net.id":32767 | |
| }, | |
| { | |
| "url":"^http://www\\.empireonline\\.com/", | |
| "pageElement":"//article", | |
| "nextLink":"//ul[contains(@class,\"paginate\")]/li[last()]/a", | |
| "wedata.net.id":2729 | |
| }, | |
| { | |
| "url":"^http://blog\\.alice-books\\.com/", | |
| "pageElement":"//div[@class='entry']", | |
| "nextLink":"id('entryNavi')/a[.='>>']", | |
| "wedata.net.id":40584 | |
| }, | |
| { | |
| "url":"^http://album\\.blog\\.yam\\.com/", | |
| "insertBefore":"//div[@class=\"pageCtrl\"]/following-sibling::*[2]", | |
| "pageElement":"id(\"albumList\")/div[@class=\"album\"]|id(\"mainContent\")/*|id(\"photobody\")/div", | |
| "nextLink":"//a[text()=\"下一頁\"]|//li[@class=\"next\"]/a", | |
| "wedata.net.id":693 | |
| }, | |
| { | |
| "url":"^https?://www\\.diigo\\.com/user/", | |
| "pageElement":"//div[@class=\"ditemItem\"]", | |
| "nextLink":"//span[@class=\"pagination\"]/span/following-sibling::a[1]", | |
| "wedata.net.id":620 | |
| }, | |
| { | |
| "url":"^https://support\\.mozilla\\.org/", | |
| "pageElement":"//div[@class='content-box']/*|//article[@class='questions']/*", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":63205 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?phun\\.jp/bbs/", | |
| "pageElement":"id(\"right_main_contents\")//tr[@bgcolor=\"#cccccc\"]", | |
| "nextLink":"//td[@class=\"num\"]/b/following-sibling::a[1]", | |
| "wedata.net.id":39108 | |
| }, | |
| { | |
| "url":"^http://store\\.natalie\\.mu/shop", | |
| "pageElement":"id(\"M_categoryList\")/ul|//table[@class=\"searchResult\"]", | |
| "nextLink":"//li[@class=\"next\"]/a|//a[.=\"[次]\"]", | |
| "wedata.net.id":54455 | |
| }, | |
| { | |
| "url":"^http://www\\.mangaku-seika\\.jp/", | |
| "pageElement":"id('mainContents')/div[@class='works']|id('mainContents')/ul[not(@id)]/li", | |
| "nextLink":"id('listNav')/strong/following-sibling::a|id('next')/a", | |
| "wedata.net.id":60493 | |
| }, | |
| { | |
| "url":"^http://www\\.cocktailtype\\.com/", | |
| "pageElement":"//table[@class='tbl']//td[2]/div[not(@class)][img][2]/following-sibling::*[following-sibling::div/b/font]", | |
| "nextLink":"//div[@class='cbx']/b/font/following-sibling::a", | |
| "wedata.net.id":77679 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?jpcoast\\.com/", | |
| "pageElement":"id(\"alpha-inner\")", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":40018 | |
| }, | |
| { | |
| "url":"^http://morningmanga\\.com/.+/\\d", | |
| "pageElement":"id('page mikakosan_main')/*", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":40011 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?carenet\\.com/", | |
| "pageElement":"//div[@class='itemSlide' or @class='searchItemList']|//div[@class='borderWrap']/div|//p[@class='titleBox mb10']", | |
| "nextLink":"//li[@class='pager-next']/a|//li[@class='on']/following-sibling::li[1]/a", | |
| "wedata.net.id":40008 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?redtube\\.com/", | |
| "pageElement":"//div[@id=\"myVideosContent\"]/ul/li | //div[@class=\"videosTable\"]/*[not(@class=\"qb\" or @class=\"pages\" or self::h1)] |//*[@id=\"myVideosContent\"] |//*[@id=\"all_pornstars\"] |//div[@class=\"galleriesTable\"]", | |
| "nextLink":"//a[@id=\"navNext\"] | //a[@title=\"Next Page\"]", | |
| "wedata.net.id":1942 | |
| }, | |
| { | |
| "url":"^http://www\\.mag2\\.com/p/money/", | |
| "pageElement":"//div[@class='main-pagination post-pagination']/preceding-sibling::*", | |
| "nextLink":"//p[@class='common_pager']/a", | |
| "wedata.net.id":79974 | |
| }, | |
| { | |
| "url":"^https?://(www\\.)?awesomedl\\.ru", | |
| "pageElement":"//div[@class='post-wrap']", | |
| "nextLink":"//div[@class='alignleft']/a", | |
| "wedata.net.id":77127 | |
| }, | |
| { | |
| "url":"^https?://thinkit\\.co\\.jp/free/", | |
| "pageElement":"id('article_main') | //div[@class='article_main'] | //tr[td/span[contains(a, '次のページ') or contains(a, '前のページ')]]/following-sibling::*[following::*[contains(., '次のページ') or contains(., '前のページ')]]", | |
| "nextLink":"descendant::a[contains(., '次のページ')][last()]", | |
| "wedata.net.id":679 | |
| }, | |
| { | |
| "url":"^http://www\\.linux-mag\\.com/id/", | |
| "pageElement":"//div[@class='story_copy']/*[not(@class='pagination')]", | |
| "nextLink":"//div[@class='pagination']/text()[translate(.,'Pages: ','')]/following-sibling::a[1]", | |
| "wedata.net.id":2631 | |
| }, | |
| { | |
| "url":"^http://www\\.3dcontentcentral\\.", | |
| "pageElement":"//div[@class=\"model-item\"]", | |
| "nextLink":"//div[@class=\"pagination\"]/span[@class=\"current\"]/following-sibling::a[1]", | |
| "wedata.net.id":76703 | |
| }, | |
| { | |
| "url":"^https://www\\.evanscycles\\.com/", | |
| "pageElement":"//div[@class='listings-items-wrapper grid bike']/div", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":39305 | |
| }, | |
| { | |
| "url":"^http://rokudena-shi\\.sblo\\.jp/", | |
| "pageElement":"id(\"content\")/div[@class=\"blog\"]", | |
| "nextLink":"id(\"content\")/div[@class=\"navi\"]/text()[number()>1 or string-length(normalize-space(translate(.,\".\",\"\")))>3]/following-sibling::a", | |
| "wedata.net.id":54513 | |
| }, | |
| { | |
| "url":"^http://bantyou\\.livedoor\\.biz/", | |
| "pageElement":"//div[@class=\"fullbody\"]", | |
| "nextLink":"//a[contains(text(),'次のページ')]", | |
| "wedata.net.id":61226 | |
| }, | |
| { | |
| "url":"^http://www\\.phppro\\.jp/school/", | |
| "pageElement":"id('school-detail-body')/*", | |
| "nextLink":"//li[@class='current']/following-sibling::li[1]/a", | |
| "wedata.net.id":1839 | |
| }, | |
| { | |
| "url":"^http://www\\.hihyosya\\.co\\.jp/", | |
| "pageElement":"//div[@class='asset-header' or @class='book-info'][div/@id]|//div[@class='asset-content entry-content']/img|id('book-buy book-brief')|//div[@class='page-top']", | |
| "nextLink":"//link[@rel='next bookmark']", | |
| "wedata.net.id":75043 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?tnaflix\\.com/", | |
| "pageElement":"//div[@class=\"sectionTitle\"]/following-sibling::div[@id or @class=\"clear\"]", | |
| "nextLink":"//li[@class=\"current\"]/following-sibling::li[1]/a", | |
| "wedata.net.id":25803 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?itworld\\.com/", | |
| "pageElement":"//div[@class='main-col']/div", | |
| "nextLink":"id('load-more-index')", | |
| "wedata.net.id":2700 | |
| }, | |
| { | |
| "url":"^http://ieiri\\.net/blog/archives", | |
| "pageElement":"//div[@class='entry-content']/*[not(@class='jp-relatedposts')]|//header[@class='entry-header']", | |
| "nextLink":"//div[@class='nav-previous']/a", | |
| "wedata.net.id":61125 | |
| }, | |
| { | |
| "url":"^http://xbrand\\.yahoo\\.co\\.jp/", | |
| "pageElement":"id('article')|//li[@class='cf' or @class='i1' or @class='i2']", | |
| "nextLink":"//li/a[@class='n next']", | |
| "wedata.net.id":1925 | |
| }, | |
| { | |
| "url":"^http://www\\.pcmag\\.com/article", | |
| "pageElement":"//section[@class='article-body']/span/*[not(a/@class='link1')]", | |
| "nextLink":"//a[@class='next-btn']", | |
| "wedata.net.id":2665 | |
| }, | |
| { | |
| "url":"^http://www\\.calciomatome\\.net/", | |
| "pageElement":"//div[@class='blog']", | |
| "nextLink":"//a[contains(.,'>>')]", | |
| "wedata.net.id":67008 | |
| }, | |
| { | |
| "url":"^http://www\\.hikaku\\.com/kaigi/", | |
| "pageElement":"//a[contains(@title,\"page\")]/following-sibling::table//tr", | |
| "nextLink":"//a[@title=\"next page\"]", | |
| "wedata.net.id":79986 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?empflix\\.com/", | |
| "pageElement":"//div[@class=\"centerSide\"]/*[self::span or (@class=\"clear\" and not(position()=last()))]", | |
| "nextLink":"//div[@class=\"pagination\"]/span[@class=\"current\"]/following-sibling::a[1]", | |
| "wedata.net.id":25806 | |
| }, | |
| { | |
| "url":"^http://cookpad\\.com/diary/list/", | |
| "pageElement":"id(\"diary\")/*", | |
| "nextLink":"//a[contains(concat(\" \", @rel, \" \"), \" next \")]", | |
| "wedata.net.id":34138 | |
| }, | |
| { | |
| "url":"^https?://www\\.nissen\\.co\\.jp/", | |
| "pageElement":"//ul[@class='item_column']/li", | |
| "nextLink":"//li[@class='current']/following-sibling::li/a", | |
| "wedata.net.id":39629 | |
| }, | |
| { | |
| "url":"^http://www\\.rollingstone\\.com/", | |
| "pageElement":"//ul[@class='primary-list']", | |
| "nextLink":"//a[.='Next']", | |
| "wedata.net.id":74846 | |
| }, | |
| { | |
| "url":"^http://www\\.elog-ch\\.com/news/", | |
| "pageElement":"id(\"content\")/h1/following-sibling::*[following-sibling::div[@class=\"caption2\"]]", | |
| "nextLink":"//a[@class=\"nextnavi\"]", | |
| "wedata.net.id":54760 | |
| }, | |
| { | |
| "url":"^http://www\\.dhbr\\.net/articles", | |
| "pageElement":"id(\"article-body-inner\")", | |
| "nextLink":"//div[@class=\"next_p\"]/a", | |
| "wedata.net.id":67274 | |
| }, | |
| { | |
| "url":"^http://(?:[^./]+\\.)*?bis\\.org/", | |
| "pageElement":"//tr[@class='item']", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":32011 | |
| }, | |
| { | |
| "url":"^http://www\\.youskbe\\.com/blog/", | |
| "pageElement":".//div[starts-with(@id,\"entry-\")]", | |
| "nextLink":".//div[@class=\"content-nav\"]//a[@class=\"link_next\"] | .//div[@class=\"content-nav\"]/p[1]/a", | |
| "wedata.net.id":33298 | |
| }, | |
| { | |
| "url":"^http://sankilogram\\.xsrv\\.jp/", | |
| "pageElement":"//div[@id=\"manga\" or @id=\"manga2\"]", | |
| "nextLink":"id(\"contents\")/div[@id=\"page\"][2]/a[last()][count(id(\"contents\")/div[@id=\"page\"][2]/a)>1]", | |
| "wedata.net.id":74836 | |
| }, | |
| { | |
| "url":"^http://www\\.world\\.co\\.jp/.+", | |
| "pageElement":"id('brandnews')/ul|//table[@class='shopList']/tbody/tr|//div[@class='wi-index-lowerList']|//div[@class='articleList']//li", | |
| "nextLink":"//li[@class='next']/a[not(contains(.,'次の記事へ'))] | //a[contains(.,'前の記事へ')] | //td[@class='wt-pager-next']/a", | |
| "wedata.net.id":64695 | |
| }, | |
| { | |
| "url":"^https?://www\\.groupon\\.com/.+", | |
| "pageElement":"id('pull-cards browse-deals')/figure", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":76357 | |
| }, | |
| { | |
| "url":"^http://www\\.zaobao\\.com\\.sg/", | |
| "pageElement":"(id('l_title')|//div[@class='itc_focus_03_item' or @class='pageList'])/ul[1]/*[self::li or @style]", | |
| "nextLink":"//li[@class='pager-next last']/a", | |
| "wedata.net.id":60968 | |
| }, | |
| { | |
| "url":"^http://techracho\\.bpsinc\\.jp/", | |
| "pageElement":"//div[@id=\"main\"]/div[@class=\"left-content\"]/ul[@class=\"article-list\"]", | |
| "nextLink":"//a[@class='nextpostslink']", | |
| "wedata.net.id":74804 | |
| }, | |
| { | |
| "url":"^http://entrepreneursmind\\.net/", | |
| "pageElement":"//div[@class=\"middle clear\"]", | |
| "nextLink":"id(\"single\")/h3/a|id(\"single\")/p//a[contains(text(),number(substring-before(substring-after(id(\"single\")/h1/text(),\"(\"),\")\"))+1)]|//a[@class=\"nextpostslink\"]|//div[@class=\"wp-pagenavi\"]/a[contains(text(),number(//span[@class=\"current\"]/text())+1)]", | |
| "wedata.net.id":61130 | |
| }, | |
| { | |
| "url":"^http://[^./]+\\.seesaa\\.net/s/", | |
| "pageElement":"id(\"list-content\")/div[@class=\"blog-list\"]|id(\"content\")/div[@class=\"blog\" or @class=\"trackback-body\" or @id=\"comments\"]", | |
| "nextLink":"//table[starts-with(@class,\"navi-\")]//td[@class=\"pager-off\"][span[number(.)>0]]/following-sibling::td/a|//td[@class=\"prev-article-on\"]/a", | |
| "wedata.net.id":61143 | |
| }, | |
| { | |
| "url":"^http://221616\\.com/sitesearch/", | |
| "pageElement":"//div[@class='searchResult']", | |
| "nextLink":"//li[@class='current']/following-sibling::li[1]/a", | |
| "wedata.net.id":64707 | |
| }, | |
| { | |
| "url":"^http://www\\.e-aidem\\.com/aps/", | |
| "pageElement":"id('kyujin_data')/*", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":60789 | |
| }, | |
| { | |
| "url":"^http://www\\.bizjournals\\.com/", | |
| "pageElement":"//div[@class='items-container']/*", | |
| "nextLink":"//a[i/@class='icon-angle-right']", | |
| "wedata.net.id":77178 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?lpaste\\.net/", | |
| "pageElement":"//table[@class='latest-pastes']//tr[td]", | |
| "nextLink":"//li[@class='page']/a[.='Next']", | |
| "wedata.net.id":2647 | |
| }, | |
| { | |
| "url":"^http://www\\.latinospost\\.com/", | |
| "pageElement":"id('subarticles')/div[@class='list']", | |
| "nextLink":"//li[@class='red']/a[(text()='Next')]", | |
| "wedata.net.id":74794 | |
| }, | |
| { | |
| "url":"^http://jigokuno\\.com/(eid|cid)", | |
| "pageElement":"//article[contains(@class,\"article\")]", | |
| "nextLink":"id('main-inner')//div[@class='nextPage']/a", | |
| "wedata.net.id":30479 | |
| }, | |
| { | |
| "url":"^http://www\\.shopgoodwill\\.com", | |
| "pageElement":"//table[@class='auctioncategories' or @class='productresults']/tbody/tr", | |
| "nextLink":"//a[.=' >>']", | |
| "wedata.net.id":76368 | |
| }, | |
| { | |
| "url":"^https://www\\.calpis\\.co\\.jp/", | |
| "pageElement":"//ul[@class='colLayout01 equalHeight']/li|//div[contains(@class,'sceneLayout01')]", | |
| "nextLink":"//p[@class='jumpBtn02']/a", | |
| "wedata.net.id":80853 | |
| }, | |
| { | |
| "url":"^http://rh\\.atlusnet\\.jp/blog/", | |
| "pageElement":"id(\"alpha-inner\")/div[position() < last()]", | |
| "nextLink":"id(\"alpha-inner\")/div[last()]/a[last()]", | |
| "wedata.net.id":39266 | |
| }, | |
| { | |
| "url":"^http://stack\\.nayutaya\\.jp/.+", | |
| "pageElement":"//*[@class='users' or @class='books']/*[not(@style)]", | |
| "nextLink":"//span[@class='current']/following-sibling::a[1]", | |
| "wedata.net.id":2628 | |
| }, | |
| { | |
| "url":"^http://thomasmayerarchive\\.de/", | |
| "pageElement":"(//a[@class='paging'][1]/ancestor::table)[2]/preceding-sibling::table/tbody/tr", | |
| "nextLink":"//a[@class='paging'][starts-with(.,'Next page')]", | |
| "wedata.net.id":680 | |
| }, | |
| { | |
| "url":"^http://www\\.imdb\\.com/search/", | |
| "pageElement":"//table[@class='results']//tr[contains(@class,'detailed')]", | |
| "nextLink":"id('right')/span[@class='pagination']/a", | |
| "wedata.net.id":74724 | |
| }, | |
| { | |
| "url":"^http://actinglikeanimals\\.com/", | |
| "pageElement":"id(\"post-area\")/*[self::h1 or @id=\"post-info\"]|id(\"content-area\")/p[./img[not(contains(@src,\"/null\"))]]", | |
| "nextLink":"//a[@rel=\"prev\"]", | |
| "wedata.net.id":77645 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?p-tina\\.net/", | |
| "pageElement":"id(\"page\")/preceding-sibling::*", | |
| "nextLink":"id(\"next\")/parent::a", | |
| "wedata.net.id":29244 | |
| }, | |
| { | |
| "url":"^http://www\\.comicbookdb\\.com/", | |
| "pageElement":"//span[@class=\"page_headline\"]/following-sibling::table//tr[.//img]", | |
| "nextLink":"//a[text()=\"Next\"]", | |
| "wedata.net.id":59946 | |
| }, | |
| { | |
| "url":"^http://realsound\\.jp/.+/post.+", | |
| "pageElement":"id(\"entryBody\")", | |
| "nextLink":"id(\"pageNext\")/a", | |
| "wedata.net.id":74711 | |
| }, | |
| { | |
| "url":"^http://web\\.gekisaka\\.jp/news", | |
| "pageElement":"//div[@class=\"player-news\"]/*[not(@class=\"back\" or @class=\"next\")]", | |
| "nextLink":"//a[text()=\"NEXT >\"]", | |
| "wedata.net.id":74704 | |
| }, | |
| { | |
| "url":"^http://tenshoku-ex\\.jp/search/", | |
| "pageElement":"//div[@class='box_job box_job_result']", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":64773 | |
| }, | |
| { | |
| "url":"^https?://www\\.chil-chil\\.net/", | |
| "pageElement":"//div[@class='CompNewsBNBox ']//li|id('UpListWrapper')//tr|//div[@class='RankingKobetsuBox']|//table[@class='QaListBox'][last()]//tr[1]/following-sibling::tr|//div[@class='CompNewsBox']/ul[last()]/preceding-sibling::*[not(self::ul)]", | |
| "nextLink":"//a[img[@alt='NEXT' or @alt='前の記事へ']]", | |
| "wedata.net.id":64687 | |
| }, | |
| { | |
| "url":"^http://answers\\.unity3d\\.com/", | |
| "pageElement":"//div[@class='node-list-item question-list-item']", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":61379 | |
| }, | |
| { | |
| "url":"^http://www\\.ss-foodlabo\\.com/", | |
| "pageElement":"//div[starts-with(@class,'sub_line_box')]", | |
| "nextLink":"//a[@class='nextback'][.='>']", | |
| "wedata.net.id":61380 | |
| }, | |
| { | |
| "url":"^http://www\\.xuldev\\.org/blog/", | |
| "pageElement":"id(\"content\")/div[contains(concat(\" \", @class, \" \"), \" entry \")]", | |
| "nextLink":"id(\"content\")/div[@class=\"navigation\"]/a[contains(text(), \"\u00ab\")]", | |
| "wedata.net.id":30760 | |
| }, | |
| { | |
| "url":"^https://m\\.fanfiction\\.net/s/", | |
| "pageElement":"id(\"storycontent\")/*", | |
| "nextLink":"id(\"d_menu\")/preceding-sibling::div[@align=\"center\"][not(count(./a)=3) or //link[@rel=\"canonical\"][contains(@href,\"/2/\")]]/a[last()]", | |
| "wedata.net.id":59647 | |
| }, | |
| { | |
| "url":"^http://www\\.naughtyblog\\.org/", | |
| "pageElement":"//div[@id='main-content']", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":80825 | |
| }, | |
| { | |
| "url":"^http://www\\.gogetaroomie\\.com", | |
| "pageElement":"//a[@rel=\"next\"]", | |
| "nextLink":"id(\"cc-comicbody\")/a", | |
| "wedata.net.id":77637 | |
| }, | |
| { | |
| "url":"^http://www\\.pn221\\.com/[^/]+/", | |
| "pageElement":"//table", | |
| "nextLink":"//table//tr[1]/td[1]/a[img[starts-with(@alt, \"P\")]]", | |
| "wedata.net.id":38806 | |
| }, | |
| { | |
| "url":"^http://www\\.menscyzo\\.com/\\d", | |
| "pageElement":"//div[contains(@class,'asset-body')]/*[following-sibling::div/@class='entpagelink']", | |
| "nextLink":"//a[@class='link_next']", | |
| "wedata.net.id":59488 | |
| }, | |
| { | |
| "url":"^http://www\\.caminspector\\.net", | |
| "pageElement":"//*[@id=\"pm-grid\"]/li | //ul[@id=\"pm-grid\"]/li", | |
| "nextLink":"//*[@id=\"primary\"]/div[4]/ul/li[last()]/a | //div[contains(@class,\"pagination\")]/ul/li[last()]/a", | |
| "wedata.net.id":77369 | |
| }, | |
| { | |
| "url":"^http://(?:[^.]+\\.)?woot\\.com/", | |
| "pageElement":"//div[starts-with(@id,'post') or starts-with(@class,'forumList clearfix')]|//section[@class='date-group']", | |
| "nextLink":"//li[@class='prev' or @class='next' or @class='older']/a", | |
| "wedata.net.id":29192 | |
| }, | |
| { | |
| "url":"^http://www\\.hareruyamtg\\.com/", | |
| "pageElement":"//div[@class='article_list ref clearfix']", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":76956 | |
| }, | |
| { | |
| "url":"^http://www\\.eonline\\.com/news", | |
| "pageElement":"//ol[starts-with(@class,'article')]/li", | |
| "nextLink":"//a[@class=\"active\"]/following-sibling::a[1]|//div[@class=\"next\"]/a[not(//a[@class=\"active\"]/following-sibling::a[1])]", | |
| "wedata.net.id":77018 | |
| }, | |
| { | |
| "url":"^http://wonderkind\\.jugem\\.jp/", | |
| "pageElement":".//div[@class=\"entry\"]", | |
| "nextLink":"id(\"pager\")/span[@class=\"current\"]/following-sibling::span[1]/a", | |
| "wedata.net.id":41372 | |
| }, | |
| { | |
| "url":"^http://www\\.cinemaonline\\.jp/", | |
| "pageElement":"id('content')/*[@class='entry' or self::h2]", | |
| "nextLink":"//div[@class='wp-pagenavi']/span[@class='current']/following-sibling::a[1]", | |
| "wedata.net.id":27242 | |
| }, | |
| { | |
| "url":"^https?://.*(forum|topic|search)", | |
| "pageElement":"id('forum_table')//tr[td]|id('ips_Posts')/div[starts-with(@id,'post_')]|//div[@class='ipsBox' or @class='ipsfocusBox']//ol[starts-with(@id,'elTable')]/li[div]|//div[starts-with(@class,'cTopic ipsClear')]//*[self::article or self::a[starts-with(@id,'comment-')]]|//div[@class='borderwrap']/table[@class='ipbtable']//*[self::tr[starts-with(td/@class,'row')]/preceding-sibling::tr[th] or self::tbody[starts-with(tr/td/@class,'post')]]|id('idm_category')/div|//div[@class='ipsAreaBackground_light ipsPad']/form/*", | |
| "nextLink":"//a[@rel='next' or ../@class='ipsPagination_next']|//span[@class='pagecurrent']/following-sibling::span[1]/a", | |
| "wedata.net.id":41434 | |
| }, | |
| { | |
| "url":"^http://ameblo\\.jp/[^/]+/image-", | |
| "pageElement":"id(\"entryInfo naviBox\")", | |
| "nextLink":"id('nextNavi') |//a[@class=\"fwd\"]", | |
| "wedata.net.id":27267 | |
| }, | |
| { | |
| "url":"^http://www\\.golfchannel\\.com/", | |
| "pageElement":"//div[@class='center-wrapper']//div[@class='view-content']/div[starts-with(@class,'views-row views-row-')]", | |
| "nextLink":"//li[@class='pager-next']/a", | |
| "wedata.net.id":77461 | |
| }, | |
| { | |
| "url":"^http://search\\.ft\\.com/search", | |
| "pageElement":"//li[starts-with(@class,'result ')]", | |
| "nextLink":"//li[@class='page next']/a", | |
| "wedata.net.id":64963 | |
| }, | |
| { | |
| "url":"^http://www\\.nearch\\.jp/[^/]+/", | |
| "pageElement":"//div[@id='main-contents']/*[@class='contents' or self::h2]", | |
| "nextLink":"//div[@class='prev']/a", | |
| "wedata.net.id":799 | |
| }, | |
| { | |
| "url":"^http://www\\.siteinspire\\.com/", | |
| "pageElement":"id('grid')/*", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":57161 | |
| }, | |
| { | |
| "url":"^http://www\\.freevectors\\.net/", | |
| "pageElement":"//section[@class='gallerys']/ul/li", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":821 | |
| }, | |
| { | |
| "url":"^http://tokyo-reimei-note\\.com/", | |
| "pageElement":"//div[@class='feature_box_01_left']|id('contents')/p[.//img[contains(@alt,'_midashi')]]/following-sibling::*[following-sibling::p[.//img[contains(@alt,'thirty_tsugi') or contains(@alt,'thirty_mae')]]]|//img[contains(@alt,'_midashi')]|//a[img[contains(@alt,'thirty_tsugi') or contains(@alt,'thirty_mae')]]/preceding-sibling::node()[not(self::a)]|id('contents')/p[img/@title='kei']/following-sibling::*[following-sibling::p[.//img[contains(@alt,'sahanji_navi_')]]]|//p/a[contains(img/@alt,'sahanji_navi_')][1]/preceding-sibling::node()[not(self::font/@color='#dc143c')]", | |
| "nextLink":"//a[@class='next page-numbers' or contains(img/@alt,'_tsugi')]", | |
| "wedata.net.id":77627 | |
| }, | |
| { | |
| "url":"^http://www\\.bookkeep\\.info/.+", | |
| "pageElement":"id(\"main_bodyside_a\")/* | //td[@class=\"myhon\"]/* | id(\"main_bodycontainer\")", | |
| "nextLink":"id(\"main_myhonbun_navi\")/a[contains(text(), \"⇒\")] | //a[@class=\"tugi\"]", | |
| "wedata.net.id":74659 | |
| }, | |
| { | |
| "url":"^http://akiba-hd\\.com/category/", | |
| "pageElement":"//div[@id=\"archive-posts\"]/*[not(@class=\"wp-pagenavi\")]", | |
| "nextLink":"//a[@class=\"nextpostslink\"]", | |
| "wedata.net.id":77709 | |
| }, | |
| { | |
| "url":"^http://kekkonsanka\\.com/search", | |
| "pageElement":"//section[@class='searchResult ']", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":41853 | |
| }, | |
| { | |
| "url":"^http://freevideolectures\\.com/", | |
| "pageElement":"id(\"content\")/div[contains(concat(\" \", @class, \" \"), \" post \")]/table/descendant::tr[position()<last()]", | |
| "nextLink":"//div[contains(concat(\" \", @class, \" \"), \" pagination \")]/span[contains(concat(\" \", @class, \" \"), \" current \")]/following-sibling::a[1]", | |
| "wedata.net.id":57123 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?animate\\.tv/", | |
| "pageElement":"id('tag')/div[@class='box']", | |
| "nextLink":"//div[@class='next']/a", | |
| "wedata.net.id":38387 | |
| }, | |
| { | |
| "url":"^http://www\\.us\\.ntt\\.com/en/", | |
| "pageElement":"//div[@class='tx-indexedsearch-res']", | |
| "nextLink":"//li[@class=\"tx-indexedsearch-browselist-currentPage\"]/following-sibling::li[1]/a", | |
| "wedata.net.id":64535 | |
| }, | |
| { | |
| "url":"^http://c-house\\.shop-pro\\.jp/", | |
| "pageElement":"//td[div[@class=\"pagenavi\"]]/*[self::div[@class=\"product_list\"] or self::br]", | |
| "nextLink":"//a[text()=\"次のページ >\"]", | |
| "wedata.net.id":74654 | |
| }, | |
| { | |
| "url":"^http://(\\d+\\.)?mitemin\\.net/", | |
| "pageElement":"//div[@class='search_box'] | //table[@class='imagebox']/parent::node()|//table[@class='imagebox']/parent::node()/following-sibling::br[1]|//table[@class='imagebox']/parent::node()/following-sibling::div[1] | id('mainContent2')//div[@class='form']|id('mainContent2')//div[@class='form']/following-sibling::br", | |
| "nextLink":"//a[@title='next page'] | id('mainContent2')/b[last()]/following-sibling::a[1] | //div[@class='change_b']/a | //div[contains(@style,'float:left')]/a[not(./img)]", | |
| "wedata.net.id":77031 | |
| }, | |
| { | |
| "url":"^http://www\\.yomiuri\\.co\\.jp/", | |
| "pageElement":"//div[@class=\"article-pagination\"][1]/preceding-sibling::*[preceding-sibling::div[@class=\"article-upper\"]]", | |
| "nextLink":"//div[@class=\"pagination\"]/ul/li[@class=\"active\"]/following-sibling::li[1]/a", | |
| "wedata.net.id":77724 | |
| }, | |
| { | |
| "url":"^https?://(?:.*\\.)?donmai\\.us/", | |
| "pageElement":"//table[@class=\"striped\"]//tr|id(\"image-container\")|id(\"posts\")|id(\"c-notes\")|id(\"c-comments\")", | |
| "nextLink":"//a[contains(@rel,\"next\")]", | |
| "wedata.net.id":74643 | |
| }, | |
| { | |
| "url":"^http://mailnesia\\.com/mailbox/", | |
| "pageElement":"//table[@class='email')]/tbody/tr", | |
| "nextLink":"id('next')", | |
| "wedata.net.id":56870 | |
| }, | |
| { | |
| "url":"^http://www\\.horindo\\.co\\.jp/", | |
| "insertBefore":"//div[@class=\"wp-pagenavi\"]", | |
| "pageElement":"//div[@class=\"entry\"]", | |
| "nextLink":"//a[@class=\"nextpostslink\"]", | |
| "wedata.net.id":77730 | |
| }, | |
| { | |
| "url":"^http://www\\.marutsu\\.co\\.jp/", | |
| "pageElement":"//div[@class='row']/li", | |
| "nextLink":"//a[span/@class='PAGING PAGING_NEXT']", | |
| "wedata.net.id":26660 | |
| }, | |
| { | |
| "url":"^http://(m\\.)?blogtruyen\\.com/", | |
| "pageElement":"//div[@class='page-home-list']/a|id('main-left')/section", | |
| "nextLink":"//div[@class=\"paging-div\"]/select/following-sibling::a[@class=\"btn btn2\"]|//span[@class='current_page']/following-sibling::span/a", | |
| "wedata.net.id":76905 | |
| }, | |
| { | |
| "url":"^https://www\\.shosen\\.co\\.jp/", | |
| "pageElement":"id(\"container\")/div[contains(concat(\" \", @class, \" \"), \" borderbox \")]", | |
| "nextLink":"//a[@class=\"nextpostslink\"]", | |
| "wedata.net.id":77735 | |
| }, | |
| { | |
| "url":"^http://netatama\\.net/archives/", | |
| "insertBefore":"id(\"column-inner-2\")/following-sibling::node()", | |
| "pageElement":"id(\"main\")/div[@class=\"column-inner\"]/div[@class=\"column-inner-2\"]/div[@class=\"article-outer hentry\"]/div[@class=\"article-outer-2\"]/div[@class=\"article-outer-3\"]/div[@class=\"article-header\"]|id(\"main\")/div[@class=\"column-inner\"]/div[@class=\"column-inner-2\"]/div[@class=\"article-outer hentry\"]/div[@class=\"article-outer-2\"]/div[@class=\"article-outer-3\"]/div[@class=\"article-body entry-content\"]|id(\"main\")/div[@class=\"column-inner\"]/div[@class=\"column-inner-2\"]/div[@class=\"article-outer hentry\"]/div[@class=\"article-outer-2\"]/div[@class=\"article-outer-3\"]/font[1]/b[1]/div[@class=\"pager article-pager-type2\"]", | |
| "nextLink":"id(\"main\")/div[@class=\"column-inner\"]/div[@class=\"column-inner-2\"]/div[@class=\"article-outer hentry\"]/div[@class=\"article-outer-2\"]/div[@class=\"article-outer-3\"]/font[1]/b[1]/div[@class=\"pager article-pager-type2\"]/div[@class=\"pager-inner\"]/div[@class=\"article-pager-outer\"]/ul[@class=\"article-pager\"]/li[@class=\"next both\"]/a[1]", | |
| "wedata.net.id":30239 | |
| }, | |
| { | |
| "url":"^http://www\\.hotamateurs\\.xxx/", | |
| "pageElement":"//div[@class=\"thumbs-list\"]", | |
| "nextLink":"//div[@class=\"pagination\"]//li[last()][not(./span)]/a", | |
| "wedata.net.id":77475 | |
| }, | |
| { | |
| "url":"^http://niceboat\\.org/jlab-20s/", | |
| "pageElement":"//span[@class=\"Current\"]/following-sibling::table//tr", | |
| "nextLink":"//span[@class=\"Current\"]/following-sibling::*[1][self::a]", | |
| "wedata.net.id":56309 | |
| }, | |
| { | |
| "url":"^http://www\\.1101\\.com/kanata/", | |
| "pageElement":"id(\"contents\")/*", | |
| "nextLink":"//a[./img[contains(@src,\"nav_next.jpg\")]]", | |
| "wedata.net.id":74509 | |
| }, | |
| { | |
| "url":"^http://hive\\.ntticc\\.or\\.jp/", | |
| "pageElement":"//div[@class='view']/ul/li", | |
| "nextLink":"//a[@class='nextpostslink']", | |
| "wedata.net.id":74953 | |
| }, | |
| { | |
| "url":"^http://online\\.mangaraw\\.net/", | |
| "pageElement":"//div[span/@id=\"gotomangainfo2\"]/following-sibling::*[following::div[@class=\"NavigateTip\"]]", | |
| "nextLink":"//a[(text()=\" Next \")]", | |
| "wedata.net.id":80935 | |
| }, | |
| { | |
| "url":"^http://sankei\\.jp\\.msn\\.com/", | |
| "pageElement":"//div[@class='NewsTextFull']/p[text()]", | |
| "nextLink":"//a[.='次のページ >']", | |
| "wedata.net.id":1208 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)viptube\\.com/", | |
| "pageElement":"//div[@class=\"upkeep\"]/div", | |
| "nextLink":"//li[@class=\"next\"]/a", | |
| "wedata.net.id":77158 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?mr-bike\\.jp/", | |
| "pageElement":"id(\"mainCol\")/p[@class=\"bottomNav\"][1]/preceding-sibling::*", | |
| "nextLink":"id(\"mainCol\")/p[@class=\"bottomNav\"]/a[contains(./text(), \"\u6b21\")]", | |
| "wedata.net.id":56065 | |
| }, | |
| { | |
| "url":"^http://www\\.nydailynews\\.com/", | |
| "pageElement":"id('content_container')//section", | |
| "nextLink":"//div[@class='pagination']//a[.='Next']", | |
| "wedata.net.id":32521 | |
| }, | |
| { | |
| "url":"^http://search\\.seznam\\.cz/\\?", | |
| "pageElement":"//div[div/@class='modCont result cr result-style']", | |
| "nextLink":"//div[@class='next']/a", | |
| "wedata.net.id":56000 | |
| }, | |
| { | |
| "url":"^http://www\\.garbagenews\\.net/", | |
| "pageElement":"//center/preceding-sibling::node()[not(@class=\"ad_rs_b\")]", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":46290 | |
| }, | |
| { | |
| "url":"^https?://issues\\.apache\\.org/", | |
| "pageElement":"id(\"issuetable\")/tbody/tr[starts-with(@id, \"issuerow\")]", | |
| "nextLink":"//a[@class=\"icon icon-next\"]", | |
| "wedata.net.id":31246 | |
| }, | |
| { | |
| "url":"^http://www\\.overclock3d\\.net/", | |
| "pageElement":"id('content')/p[position()>1]", | |
| "nextLink":"//a[@title='Next']", | |
| "wedata.net.id":77322 | |
| }, | |
| { | |
| "url":"^http://katteniys\\.tumblr\\.com", | |
| "pageElement":"id('content')/div[not(@class='pagination')]", | |
| "nextLink":"//span[@class='next-page']/a", | |
| "wedata.net.id":77752 | |
| }, | |
| { | |
| "url":"^http://www\\.startribune\\.com/", | |
| "pageElement":"//div[@class='l-section-inner']/div[starts-with(normalize-space(@class),'tease has-art')]", | |
| "nextLink":"//a[@class='spill-pagination-next btn-small']", | |
| "wedata.net.id":29050 | |
| }, | |
| { | |
| "url":"^http://www\\.skankhunter\\.com/", | |
| "pageElement":"//li[@class=\"thumbnail\"]", | |
| "nextLink":"//a[@class=\"next\"]", | |
| "wedata.net.id":55956 | |
| }, | |
| { | |
| "url":"^http://yamarena\\.seesaa\\.net/", | |
| "insertBefore":"id(\"content\")/div[@class=\"hfeed\"]/node()[last()]", | |
| "pageElement":"//div[@class=\"blog\"]", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":1324 | |
| }, | |
| { | |
| "url":"^https?://[^./]+\\.heureka\\.cz/", | |
| "pageElement":"id(\"search\")//div[contains(concat(\" \", @class, \" \"), \" product \")] | id(\"product-container\")/div[contains(concat(\" \", @class, \" \"), \" p \")] | id('product-discount')/div[contains(concat(\" \", @class, \" \"), \" item \")]", | |
| "nextLink":"//a[contains(concat(\" \", @class, \" \"), \" next \")]", | |
| "wedata.net.id":55933 | |
| }, | |
| { | |
| "url":"^http://www\\.spankwire\\.com/.+", | |
| "pageElement":"//*[@id=\"main-area\"]/ul/li", | |
| "nextLink":"//*[@class=\"x-grad-pagination next-prev border-radius-5-right pagination-buttons\"]/a", | |
| "wedata.net.id":32501 | |
| }, | |
| { | |
| "url":"^http://www\\.howtogeek\\.com/.+", | |
| "pageElement":"//div[@class='entry' or starts-with(@class,'nwSep')]", | |
| "nextLink":"//span[@class='current']/following-sibling::a[1]", | |
| "wedata.net.id":77760 | |
| }, | |
| { | |
| "url":"^http://[^.]+\\.answers\\.com/Q/", | |
| "pageElement":"id(\"search-results\")/*|//ul[@class=\"subCats\"]/span|//div[@class='questions']/*", | |
| "nextLink":"//a[contains(.,'>')]", | |
| "wedata.net.id":32494 | |
| }, | |
| { | |
| "url":"^http://ochisatsu\\.com/auction/", | |
| "pageElement":"//p[a[contains(@href,\"yahoo.co.jp\")]]/following-sibling::*[following-sibling::hr]", | |
| "nextLink":"//td/b[number(.)>0]/following-sibling::a", | |
| "wedata.net.id":76295 | |
| }, | |
| { | |
| "url":"^http://www\\.marketwatch\\.com/", | |
| "pageElement":"id('article-pagination')/preceding-sibling::*[not(starts-with(@id,'ad-'))]", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":74152 | |
| }, | |
| { | |
| "url":"^https?://(www\\.)?irfree\\.com/", | |
| "pageElement":"//div[@class='panel panel-default my-panel']", | |
| "nextLink":"//div[@class='navigation']/a[last()]", | |
| "wedata.net.id":28993 | |
| }, | |
| { | |
| "url":"^http://www\\.tbsradio\\.jp/dig/", | |
| "pageElement":"id(\"main\")/div[contains(concat(\" \",normalize-space(@class),\" \"),\" entry \")]", | |
| "nextLink":"//a[contains(concat(\" \",normalize-space(@class),\" \"),\" link_next \")]", | |
| "wedata.net.id":36610 | |
| }, | |
| { | |
| "url":"^http://bonet\\.info/(?:all|tag)", | |
| "pageElement":"//div[@class='post']", | |
| "nextLink":"//a[@class='next page-numbers']", | |
| "wedata.net.id":74086 | |
| }, | |
| { | |
| "url":"^http://video\\.baidu\\.com/v\\?", | |
| "pageElement":"//li[@class='result']", | |
| "nextLink":"//a[@class='filter-item next-page-btn']", | |
| "wedata.net.id":25622 | |
| }, | |
| { | |
| "url":"^http://dengekibunko\\.jp/books/", | |
| "pageElement":"//table[.//tr[1]/td[1][@valign][@style]//img[contains(@src,\"arrow_left.png\")]]", | |
| "nextLink":"//a[contains(img/@src, \"arrow_left.png\")]", | |
| "wedata.net.id":77611 | |
| }, | |
| { | |
| "url":"^http://blog\\.iphone-dev\\.org/", | |
| "pageElement":"//div[@class=\"posts\"]", | |
| "nextLink":"//a[text()=\"Older Posts\"]", | |
| "wedata.net.id":29465 | |
| }, | |
| { | |
| "url":"^http://blog\\.unfindable\\.net/", | |
| "pageElement":"//article[contains(@class,\"post\")]|id(\"comments\")", | |
| "nextLink":"//a[@rel=\"prev\"]", | |
| "wedata.net.id":80709 | |
| }, | |
| { | |
| "url":"^http://cm3d2pre\\.ry-all\\.net/", | |
| "pageElement":"//div[@id=\"content-wrapper\"]/div[@class=\"preset-cards\"]/div[@class=\"preset-card-container\"]", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":77499 | |
| }, | |
| { | |
| "url":"^http://search\\.blogmura\\.com/", | |
| "pageElement":"id(\"alpha-block\")/div[@class=\"results-body\"]/ol[@class=\"entry\"]", | |
| "nextLink":"id(\"alpha-block\")/div[@class=\"page-tab\"]//span[.=\"\u6b21\u3078\"]/parent::a", | |
| "wedata.net.id":27464 | |
| }, | |
| { | |
| "url":"^http://www\\.museum-cafe\\.com/", | |
| "pageElement":"id(\"result\")/div[contains(concat(\" \", @class, \" \"), \" wrap \")]/dl", | |
| "nextLink":"id(\"result\")//li[contains(concat(\" \", @class, \" \"), \" next \")]/a", | |
| "wedata.net.id":49351 | |
| }, | |
| { | |
| "url":"^http://www\\.wanibookout\\.com/", | |
| "pageElement":"//div[@class=\"postpage\"]/preceding-sibling::*[not(contains(@class,\"wp_social_bookmarking_light\") or @id=\"postheading\" or @id=\"meta\")]|//*[./div[@class=\"postpage\"]]/preceding-sibling::*[not(contains(@class,\"wp_social_bookmarking_light\") or @id=\"postheading\" or @id=\"meta\")]|//div[contains(@class,\"post-\")][./ancestor::div[@class=\"archive-list\"]]", | |
| "nextLink":"//div[@class=\"postpage\"]/span/following-sibling::a[1]|//div[@class=\"next\"]/a[contains(@href,\"/category/\")]", | |
| "wedata.net.id":80707 | |
| }, | |
| { | |
| "url":"^http://search\\.fresheye\\.com/", | |
| "pageElement":"//div[@class='rslt news']//li", | |
| "nextLink":"//div[@class='sum']/a[contains(.,'次の')]", | |
| "wedata.net.id":73898 | |
| }, | |
| { | |
| "url":"^http://(www\\.)?noisemp3\\.com/", | |
| "pageElement":"id(\"mainContent\")/div[@class=\"trackItem\"]", | |
| "nextLink":"id(\"mainContent\")/div[@class=\"nArea\"]/div/a[contains(text(), \"next\")]", | |
| "wedata.net.id":25654 | |
| }, | |
| { | |
| "url":"^http://ototoy\\.jp/newreleases/", | |
| "pageElement":"id(\"releases\")/*[not(self::h1)]", | |
| "nextLink":"id('newrelease-tab')/li[@class='current']/following-sibling::li[1]/a", | |
| "wedata.net.id":77297 | |
| }, | |
| { | |
| "url":"^http://bidders\\.jp/bep/m/klist", | |
| "pageElement":"id('js-switchView-pannel')/ul/li", | |
| "nextLink":"//a[@class='stIconMd-keyboard-arrow-right']", | |
| "wedata.net.id":65650 | |
| }, | |
| { | |
| "url":"^http://www\\.littlebudha\\.com/", | |
| "pageElement":"id('main primary')/section/*[self::article or article]", | |
| "nextLink":"//a[@class='next page-numbers']", | |
| "wedata.net.id":77143 | |
| }, | |
| { | |
| "url":"^http://www\\.sweclockers\\.com/", | |
| "pageElement":"//div[@class='newsList' or @class='articleList' or @class='forumPosts']/*", | |
| "nextLink":"//a[@class='readMoreArchive' or @rel='next']", | |
| "wedata.net.id":65681 | |
| }, | |
| { | |
| "url":"^http://www\\.trademe\\.co\\.nz/", | |
| "pageElement":"id('listing-cards')/*|//div[@class='supergrid-overlord ']/*", | |
| "nextLink":"//td[@align='center' or @style='text-align:center']/b/following-sibling::a[1]", | |
| "wedata.net.id":65716 | |
| }, | |
| { | |
| "url":"^http://pentax\\.photoble\\.net/", | |
| "pageElement":"id('PageBody')/*", | |
| "nextLink":"//a[contains(text(),'>>')]", | |
| "wedata.net.id":2116 | |
| }, | |
| { | |
| "url":"^http://www\\.qiushibaike\\.com/", | |
| "pageElement":"id(\"content-left\")/div[1][./div[@class=\"menu_list\"]]/following-sibling::div[@id]", | |
| "nextLink":"//a[span/@class='next']", | |
| "wedata.net.id":73809 | |
| }, | |
| { | |
| "url":"^http://www\\.limemo\\.net/blog/", | |
| "pageElement":"//div[@class=\"post\"]", | |
| "nextLink":"//a[@class=\"nextpostslink\"]", | |
| "wedata.net.id":73799 | |
| }, | |
| { | |
| "url":"^http://www\\.fakku\\.net/forums", | |
| "pageElement":"id(\"view_topic\") | id(\"comments right\")/div[contains(@class,\"comment\") or contains(@class,\"related\")]", | |
| "nextLink":"//a[(text()=\"Next\")]", | |
| "wedata.net.id":29839 | |
| }, | |
| { | |
| "url":"^http://www\\.sonicgarden\\.jp/.", | |
| "pageElement":"id(\"section\")/following-sibling::*[@class=\"int-box\" or self::p]|id(\"section\")", | |
| "nextLink":"id(\"main\")/article/div[@class=\"body\"]/div[not(@class)]/p/a", | |
| "wedata.net.id":80698 | |
| }, | |
| { | |
| "url":"^http://www\\.theinquirer\\.net/", | |
| "pageElement":"//div[@class='review-nav-link']/preceding-sibling::*", | |
| "nextLink":"//a[@class='next_page']", | |
| "wedata.net.id":76498 | |
| }, | |
| { | |
| "url":"^http://www\\.dailymotion\\.com/", | |
| "pageElement":"//div[@class=\"js-list-grid\"]|//div[contains(@class,\"js-list-list\")]/div", | |
| "nextLink":"//div[contains(concat(\" \",@class,\" \"),\" pages \")]/a[contains(concat(\" \",@class,\" \"),\" icon-arrow_right \")]", | |
| "wedata.net.id":2075 | |
| }, | |
| { | |
| "url":"^http://(www\\.)?webcreme\\.com/", | |
| "pageElement":"id('container')/*[@class='image' or @class='desc' or @class='hr'][preceding-sibling::img[1]][following-sibling::img[last()-1]]", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":2068 | |
| }, | |
| { | |
| "url":"^http://www\\.gourmetpens\\.com/", | |
| "pageElement":"//div[@class='blog-posts hfeed']", | |
| "nextLink":"//a[@class='blog-pager-older-link']", | |
| "wedata.net.id":77837 | |
| }, | |
| { | |
| "url":"http://www\\.morinaga\\.co\\.jp/", | |
| "pageElement":"//ul[@class='recipeList']", | |
| "nextLink":"id('pagerNext')", | |
| "wedata.net.id":80693 | |
| }, | |
| { | |
| "url":"^http://www\\.locondo\\.jp/shop/", | |
| "pageElement":"id('catalog_list')/*", | |
| "nextLink":"//li[@class='pager-next']/a", | |
| "wedata.net.id":53606 | |
| }, | |
| { | |
| "url":"^http://www\\.devarticles\\.com/", | |
| "pageElement":"//div[a/@class=\"bignextlink\"]/preceding-sibling::*[not(@class=\"contentpagetitle\" or self::br[not(@class)])]|id(\"disqus_thread\")[not(//a[@class=\"bignextlink\"])]/preceding-sibling::*[not(@class=\"contentpagetitle\" or self::br[not(@class)])]", | |
| "nextLink":"//a[@class='bignextlink']", | |
| "wedata.net.id":35301 | |
| }, | |
| { | |
| "url":"^http://dw\\.diamond\\.ne\\.jp/.", | |
| "pageElement":"id('article-body')/*[not(contains(@class,'pagination'))]|//li[@class='search-result']", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":77600 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?fapdu\\.com.+", | |
| "pageElement":"//ol[@id=\"load-more\"]/li", | |
| "nextLink":"//a[@id=\"lm\"]", | |
| "wedata.net.id":53654 | |
| }, | |
| { | |
| "url":"^http://arstechnica\\.com/civis/", | |
| "pageElement":"//tr[td[@class=\"topic-title\"]/a[not(@class=\"topictitle important\")]]|//table[starts-with(@class,\"post \")]", | |
| "nextLink":"id(\"top-actionbar\")//li[@class=\"selected\"]/following-sibling::li[1]/a", | |
| "wedata.net.id":32400 | |
| }, | |
| { | |
| "url":"^http://www\\.soccer-king\\.jp/.", | |
| "pageElement":"//div[@class='archives-list']/*", | |
| "nextLink":"//div[contains(@class,'pagenav-next')]/a", | |
| "wedata.net.id":66475 | |
| }, | |
| { | |
| "url":"^http://teezeit\\.en-grey\\.com/", | |
| "pageElement":"id(\"EntryBlock\")/div[@class=\"EntryInnerBlock\" or @class=\"CommentBlock\"]", | |
| "nextLink":"id(\"EntryBlock\")/div[@class=\"PageLinkBlock\"]/text()[string-length(normalize-space(translate(.,\"[]\",\"\")))>1]/following-sibling::a", | |
| "wedata.net.id":53928 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?amiz\\.jp/\\?", | |
| "pageElement":"//td[@class=\"full_content\"]/table//table[contains(.//div,\"\u4ef6\u3092\u8868\u793a\")]/following-sibling::node()[self::table[not(contains(.//div,\"\u4ef6\u3092\u8868\u793a\"))] or position()=last()]", | |
| "nextLink":"//div[@class=\"padding_s\"]/a[contains(.,\"\uff1c\uff1c\") and not(following::div[@class=\"padding_s\"]/a=\"\u6b21\u3092\u8868\u793a\") or .=\"\u6b21\u3092\u8868\u793a\"]", | |
| "wedata.net.id":31703 | |
| }, | |
| { | |
| "url":"^http://books\\.cccmh\\.co\\.jp/", | |
| "pageElement":"//div[@class='layout-box summary-container']/dl", | |
| "nextLink":"id('pager')/a[last()]", | |
| "wedata.net.id":77278 | |
| }, | |
| { | |
| "url":"^http://animeanime\\.jp/article/", | |
| "pageElement":"//article[contains(concat(\" \",@class,\" \"),\" arti-body \")]", | |
| "nextLink":"//li[contains(concat(\" \",@class,\" \"),\" paging-next \")]/a", | |
| "wedata.net.id":72643 | |
| }, | |
| { | |
| "url":"^http://[^.]+\\.cafepress\\.com/", | |
| "pageElement":"//div[@class='grid-unit clearfix']", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":438 | |
| }, | |
| { | |
| "url":"^http://www\\.nba\\.co\\.jp/nba/", | |
| "pageElement":"//div[@itemprop=\"articleBody\"]/blockquote[last()]/preceding-sibling::*|//h1[@class=\"article-headline\"]", | |
| "nextLink":"//a[(text()=\"次のページ >>>\")]", | |
| "wedata.net.id":80979 | |
| }, | |
| { | |
| "url":"^http://www\\.betamarker\\.com/*", | |
| "insertBefore":"id(\"pageNav\")", | |
| "pageElement":"//div[@class=\"ListBetaItems\"]", | |
| "nextLink":"id(\"pageNav\")//a[@class=\"Next\"]", | |
| "wedata.net.id":428 | |
| }, | |
| { | |
| "url":"^http://[^.]+\\.trekearth\\.com/", | |
| "pageElement":"//ul[@class=\"photo-list\"]|//div[contains(concat(\" \", @class, \" \"), \" featured-holder \")]|//div[@class=\"member-table-box\"]", | |
| "nextLink":"//div[contains(concat(\" \", @class, \" \"), \" page-nav \")]//li[./strong]/following-sibling::li[./a][1]/a", | |
| "wedata.net.id":32274 | |
| }, | |
| { | |
| "url":"^http://www\\.transit\\.ne\\.jp/", | |
| "pageElement":"//div[@class='box1 linkbox']|id('main-contents')", | |
| "nextLink":"id('contents')//div[@class='paginate']/a[last()]|id('main-contents')//div[@id='appendix']//li[last()]/a", | |
| "wedata.net.id":72603 | |
| }, | |
| { | |
| "url":"^http://www\\.aniplex\\.co\\.jp/", | |
| "pageElement":"id(\"left-containerIn\")/div[@id]", | |
| "nextLink":"//a[@title=\"NEXT\"]", | |
| "wedata.net.id":63643 | |
| }, | |
| { | |
| "url":"^http://www\\.tubemonsoon\\.com/", | |
| "pageElement":"id(\"inner_right\")/ul[contains(concat(\" \", @class, \" \"), \" results \")]", | |
| "nextLink":"id(\"slider\")/a[.=\"Next\"]", | |
| "wedata.net.id":54297 | |
| }, | |
| { | |
| "url":"^http://www\\.mag2\\.com/p/news/", | |
| "pageElement":"//div[contains(concat(' ',@class,' '),\" page-links \")][preceding-sibling::p/@class='nxplink' or not(//span[@class=\"page-numbers\"]/following-sibling::a)]/preceding-sibling::*[not(self::div or self::script)]|//div[contains(concat(' ',@class,' '),' page-links ')][not(preceding-sibling::p/@class='nxplink')][//span[@class='page-numbers']/following-sibling::a]/preceding-sibling::p[a][1]/preceding-sibling::*[not(self::div or self::script)]", | |
| "nextLink":"//div[@class='page-links']/text()[string-length(normalize-space()) > 0][last()]/following-sibling::a[1]", | |
| "wedata.net.id":77236 | |
| }, | |
| { | |
| "url":"^http://tieba\\.baidu\\.com/p/.+", | |
| "pageElement":"//div[@class=\"p_postlist\"]/div[starts-with(@class, 'l_post')]", | |
| "nextLink":"//div[@class=\"pb_footer\"]//a[starts-with(text(), '下一页')]", | |
| "wedata.net.id":80981 | |
| }, | |
| { | |
| "url":"^http://www\\.gizmodo\\.co\\.uk/", | |
| "pageElement":"id('maincontentlist')/section/article", | |
| "nextLink":"//a[i/@class='fa fa-angle-right fa-lg']", | |
| "wedata.net.id":77139 | |
| }, | |
| { | |
| "url":"^http://dual\\.nikkei\\.co\\.jp/", | |
| "pageElement":"id(\"box_left\")/article/div[@class=\"detail_content\"]", | |
| "nextLink":"//div[@class=\"wp-pagenavi\"]/span[@class=\"current\"]/following-sibling::a[1][//meta[@property=\"og:url\"][not(contains(@content,\"&page=\"))] or contains(@href,concat(\"&page=\",number(substring-after(//meta[@property=\"og:url\"]/@content,\"&page=\"))+1))]", | |
| "wedata.net.id":76658 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?theync\\.com/", | |
| "pageElement":"//div[@class=\"post\"]", | |
| "nextLink":"//a[@class=\"fs\"]/following-sibling::a[1]", | |
| "wedata.net.id":2002 | |
| }, | |
| { | |
| "url":"^http://pc\\.nikkeibp\\.co\\.jp/", | |
| "pageElement":"//div[@class='settle01']//li|//div[@class='settle02']/*", | |
| "nextLink":"//a[.//text()=\"次へ\"]", | |
| "wedata.net.id":79956 | |
| }, | |
| { | |
| "url":"^http://taisyoku-simasita\\.com/", | |
| "pageElement":"id(\"body\")/div[./div[@class=\"article_list_title\"]]", | |
| "nextLink":"//ul[@class=\"pager\"]/li/a[text()=\"次のページ>\"]", | |
| "wedata.net.id":76676 | |
| }, | |
| { | |
| "url":"^http://www\\.coldturbine\\.com/", | |
| "pageElement":"//p[@class=\"Menu\"]/following-sibling::*[following-sibling::p[@class=\"Menu\"]]", | |
| "nextLink":"//p[@class=\"Menu\"]/a[contains(.,\"Next\")]", | |
| "wedata.net.id":76680 | |
| }, | |
| { | |
| "url":"^http://www\\.sakurasaori\\.net/", | |
| "pageElement":"id('content')/div[not(@class='navigation' or @class='cmtr')]", | |
| "nextLink":"//div[@class='alignright']/a", | |
| "wedata.net.id":31825 | |
| }, | |
| { | |
| "url":"^http://www\\.dospara\\.co\\.jp/", | |
| "pageElement":"//table[@class='table itemSearchTable']/tbody/tr", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":33760 | |
| }, | |
| { | |
| "url":"^http://[^./]+\\.diarynote\\.jp/", | |
| "pageElement":"id(\"main\")/*[not(contains(\" show_pager pages \",concat(\" \",@class,\" \")))]", | |
| "nextLink":"id(\"main\")/p/span/span/following-sibling::a|id(\"main\")/div[@class=\"show_pager\"]/div[@class=\"prev\"]/a", | |
| "wedata.net.id":54452 | |
| }, | |
| { | |
| "url":"^http://www\\.inquisitr\\.com/.+", | |
| "pageElement":"//div[@class='containerblock row timeline']/*", | |
| "nextLink":"//div[@class='pagination--link m-next']/a", | |
| "wedata.net.id":76698 | |
| }, | |
| { | |
| "url":"^http://dap\\.mediachance\\.com/", | |
| "pageElement":"//div[@class='post' or @class='clear']", | |
| "nextLink":"//div[@class='nav-previous']/a", | |
| "wedata.net.id":63529 | |
| }, | |
| { | |
| "url":"^http://www\\.extremetech\\.com/", | |
| "pageElement":"id('intelliTXT')/*|//ul[@class='block-grid-1']/li", | |
| "nextLink":"//li[@class='next']/a|//a[@class='btn-prev']", | |
| "wedata.net.id":33992 | |
| }, | |
| { | |
| "url":"^http://s[^.]\\.artemisweb\\.jp/", | |
| "pageElement":"//center[h1][p]/a/img|//center[h1][p]/img|//center[h1]/font/a/img", | |
| "nextLink":"//center[h1][p]/a[img]", | |
| "wedata.net.id":29725 | |
| }, | |
| { | |
| "url":"^http://www\\.tinami\\.com/blog/", | |
| "pageElement":"id(\"content\")/div[@class=\"post\"]|id(\"content\")/h1/following-sibling::*[following-sibling::div[@class=\"navigation\"]]", | |
| "nextLink":"id(\"content\")/div[@class=\"navigation\"]//span[@class=\"prevlink\"]/a|//link[@rel=\"prev\"]", | |
| "wedata.net.id":70110 | |
| }, | |
| { | |
| "url":"^http://ranking\\.goo\\.ne\\.jp/", | |
| "pageElement":"//ol[@class='article-archive ranking-list']/li", | |
| "nextLink":"id('ranking_pager_next')", | |
| "wedata.net.id":29659 | |
| }, | |
| { | |
| "url":"^http://g2\\.kodansha\\.co\\.jp/", | |
| "pageElement":"//div[@class=\"article back-g2\"]", | |
| "nextLink":"//div[@class=\"pagenavi\"]/a[contains(.,\"≫\")]", | |
| "wedata.net.id":70096 | |
| }, | |
| { | |
| "url":"^http://www\\.at-x\\.com/program", | |
| "pageElement":"id(\"timeTable\")", | |
| "nextLink":"//div[@class=\"right week\"]/a", | |
| "wedata.net.id":54594 | |
| }, | |
| { | |
| "url":"^http://mook\\.u-car\\.com\\.tw/", | |
| "pageElement":"//div[@class='moremooklist' or @class='postcont']", | |
| "nextLink":"//div[@class='linkmooklist' or @class='nextpage']/a", | |
| "wedata.net.id":76736 | |
| }, | |
| { | |
| "url":"^https?://www\\.heise\\.de/forum", | |
| "pageElement":"id('tree_thread_list')/li", | |
| "nextLink":"//a[@class='newer shortcut-d']", | |
| "wedata.net.id":77242 | |
| }, | |
| { | |
| "url":"^https://groups\\.drupal\\.org/.", | |
| "pageElement":"id('content')//div[@class='view-content']//li", | |
| "nextLink":"//li[@class='pager-next last']/a", | |
| "wedata.net.id":54714 | |
| }, | |
| { | |
| "url":"^http://labaq\\.com/(?!archives)", | |
| "pageElement":"//div[@class='fullbody']", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":67066 | |
| }, | |
| { | |
| "url":"^http://woodbook\\.xyz/archives/", | |
| "pageElement":"//div[contains(concat(\" \", @class, \" \"), \" post \")]//section", | |
| "nextLink":"//div[contains(concat(\" \", @class, \" \"), \" p-navi \")]//dt[contains(text(), \"NEXT\")]/following-sibling::dd//a", | |
| "wedata.net.id":80994 | |
| }, | |
| { | |
| "url":"^http://diamond\\.jp/articles/-/", | |
| "pageElement":"//div[@id='mp-ie' or @id='multipage']/preceding-sibling::*[not(@id='title-parts' or @class='common-recommend-kouzamanual' or @class='breadcrumb' or @id='signage' or @class='contents-info clearfix' or @id='next-info' or starts-with(@class, 'smartparts-info') or @id='NWrelart:Body')] | id('main-contents')/*[@id='NWrelart:Body']/* | id('main-contents')/*[not(@id='NWrelart:Body') and not(@id='next-info') and following-sibling::*[@id='multipage-top']]", | |
| "nextLink":"(//*[contains(concat(' ', @class, ' '), ' next-p ') or contains(concat(' ', @class, ' '), ' next_p ') or contains(concat(' ', @class, ' '), ' next_p-top ') or contains(span, '次のページ')]/a)[1]", | |
| "wedata.net.id":31984 | |
| }, | |
| { | |
| "url":"^http://(?:www|jp)\\.vice\\.com/", | |
| "pageElement":"//*[starts-with(@class,'pagination')]/preceding-sibling::*//*[self::li[ancestor::div[contains(@class,'normal')]] or self::article or ..[contains(concat(' ',@class,' '),' article-body ')]]", | |
| "nextLink":"//li[@class='active_page' or @class='current']/following-sibling::li[1]/a|//li[@class='next ctrl']/a", | |
| "wedata.net.id":77524 | |
| }, | |
| { | |
| "url":"^http://www\\.gamereactor\\.eu/", | |
| "pageElement":"(id('textlist')|//form)/article", | |
| "nextLink":"//a[(.|..)/@class='next']", | |
| "wedata.net.id":77363 | |
| }, | |
| { | |
| "url":"^https?://www\\.gocomics\\.com/", | |
| "pageElement":"//div[@class=\"STR_StripFrame\"]", | |
| "nextLink":"//a[contains(@class,\"PAG_Next\")]", | |
| "wedata.net.id":29481 | |
| }, | |
| { | |
| "url":"^http://onsen\\.nifty\\.com/cs/", | |
| "pageElement":"//ul[@class='searchResultList']/li", | |
| "nextLink":"//a[@class='next last']", | |
| "wedata.net.id":29660 | |
| }, | |
| { | |
| "url":"^http://[^.]+\\.impressrd\\.jp/", | |
| "pageElement":"id(\"content-area\")//div[@class=\"field_body\"]/*", | |
| "nextLink":"id(\"content-area\")//div[@class=\"field_body\"]/*[last() and self::h2]/a", | |
| "wedata.net.id":416 | |
| }, | |
| { | |
| "url":"^http://www\\.girls-style\\.jp/", | |
| "pageElement":"//table[@class='sotp_table'][position()>1]|//div[@class='interview']", | |
| "nextLink":"//a[contains(.,'につづく') or img/@alt='次のページ' or ../@class='next'] | //link[@rel='prev'] | //td[@align='LEFT']/a[contains(.,'←')]", | |
| "wedata.net.id":63202 | |
| }, | |
| { | |
| "url":"^http://monchicon\\.jugem\\.jp/", | |
| "pageElement":".//div[@class=\"entry\"]", | |
| "nextLink":".//li[@class=\"next\"]/a | .//div[@class=\"entry_navi\"]/a[not(@href=\"./\")][1]", | |
| "wedata.net.id":34327 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?globis\\.jp/", | |
| "pageElement":"//ul[@class=\"archive-list\"]/li", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":29885 | |
| }, | |
| { | |
| "url":"^http://www\\.sapporobeer\\.jp/", | |
| "pageElement":"//div[@class='saparate4column']|//div[@class='format-tableA01']//tbody/tr", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":63931 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)iceporn\\.com", | |
| "pageElement":"//*[@class=\"prime_frame\"]|//form[@class=\"form_fav\"]", | |
| "nextLink":"//a[text()=\"Next »\"]", | |
| "wedata.net.id":77154 | |
| }, | |
| { | |
| "url":"^http://www\\.tf2outpost\\.com/", | |
| "pageElement":"//div[@class=\"trade\"]", | |
| "nextLink":"id(\"pagination\")/a[@class=\"selected\"]/following-sibling::a[1]", | |
| "wedata.net.id":62575 | |
| }, | |
| { | |
| "url":"^http://twin-angel\\.com/comic/", | |
| "pageElement":"id(\"box\")//div[a/img]", | |
| "nextLink":"//div[@class='controller']//table//div/a[contains(preceding-sibling::text(),'||')]", | |
| "wedata.net.id":62557 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?zickr\\.com/", | |
| "pageElement":"//div[@class=\"entry\"]", | |
| "nextLink":"//span[@class=\"current\"]/following-sibling::a[1]", | |
| "wedata.net.id":34578 | |
| }, | |
| { | |
| "url":"^https://yts\\.ag/browse-movies", | |
| "pageElement":"//section/div[@class=\"row\"]/div", | |
| "nextLink":"//li[./a[@class=\"current\"]]/following-sibling::li[1]/a", | |
| "wedata.net.id":80939 | |
| }, | |
| { | |
| "url":"^http://dl\\.rakuten\\.co\\.jp/", | |
| "pageElement":"//div[@id='tbl']", | |
| "nextLink":"//b[@class='next']/a | //div[@class='bg2']/span[@class='lnk'][last()]/a", | |
| "wedata.net.id":30215 | |
| }, | |
| { | |
| "url":"^https?://.*\\.esa\\.io/posts.*", | |
| "pageElement":"//ul[@class='post-list']/li", | |
| "nextLink":"//span[@class='next']/a", | |
| "wedata.net.id":77543 | |
| }, | |
| { | |
| "url":"^http://urbanhonking\\.com/owl/", | |
| "pageElement":"id(\"content\")/div[1]", | |
| "nextLink":"//div[@class=\"date\"]/a[1][./following-sibling::ul[@class=\"menu\"]]", | |
| "wedata.net.id":524 | |
| }, | |
| { | |
| "url":"^http://www\\.supermodels\\.nl/", | |
| "pageElement":"//td[@width='320']/*[@class='modelimages' or @style='clear:both']|//tr[td/span/@class='dateleft']", | |
| "nextLink":"//a[.='Next page' or .='Previous 50 >']", | |
| "wedata.net.id":532 | |
| }, | |
| { | |
| "url":"^http://dotplace\\.jp/archives/", | |
| "pageElement":"//article/p[./strong/a]/preceding-sibling::*[./preceding-sibling::h2[@class=\"selector01\"]]|//article/p[last()][not(./preceding-sibling::p/strong/a)]/preceding-sibling::*[./preceding-sibling::h2[@class=\"selector01\"]]|//article/h2[@class=\"selector01\"][1]|//article/h2[@class=\"selector01\"][1]/preceding-sibling::p[1]", | |
| "nextLink":"//article/p/strong/a", | |
| "wedata.net.id":80928 | |
| }, | |
| { | |
| "url":"^http://www\\.javjunkies\\.com/", | |
| "insertBefore":"<?php sleep(30); ?php>", | |
| "pageElement":"//div[@class=\"p0st-container\"]", | |
| "nextLink":"//a[contains(text(), \"« Previous\")]", | |
| "wedata.net.id":62095 | |
| }, | |
| { | |
| "url":"^http://www\\.hotukdeals\\.com/", | |
| "pageElement":"//div[starts-with(@id,'thread_')]", | |
| "nextLink":"//a[@class=' paginationButton--arrow-next']", | |
| "wedata.net.id":34786 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?jusci\\.net/", | |
| "pageElement":"//article", | |
| "nextLink":"//li[@class='pager-next']", | |
| "wedata.net.id":34829 | |
| }, | |
| { | |
| "url":"^http://tumblr\\.forgifs\\.com/", | |
| "pageElement":"id(\"navigation\")/preceding-sibling::*", | |
| "nextLink":"id(\"navigation\")[count(./a)>1 or ./a[@href=\"/page/2\"]]/a[last()]", | |
| "wedata.net.id":80882 | |
| }, | |
| { | |
| "url":"^http://www\\.focalprice\\.com/", | |
| "pageElement":"id(\"list_content\")", | |
| "nextLink":"//a[@class=\"next\"]", | |
| "wedata.net.id":61457 | |
| }, | |
| { | |
| "url":"^http://mixi\\.jp/show_log\\.pl", | |
| "pageElement":"//ul[@class=\"logList01\"]", | |
| "nextLink":"//div[contains(@class, \"bottom\")]/div[@class=\"pageList02\"]/ul/li/a", | |
| "wedata.net.id":606 | |
| }, | |
| { | |
| "url":"^https://flippa\\.com/websites/", | |
| "pageElement":"id('searchBody')/div/ul", | |
| "nextLink":"//a[@class='Pagination___pageLink Pagination___nextLink Pagination___prevLink']", | |
| "wedata.net.id":34866 | |
| }, | |
| { | |
| "url":"^http://articles\\.mcall\\.com/", | |
| "pageElement":"id(\"area-center-w-left\")/div[contains(concat(\" \", @class, \" \"), \" mod-articletext \")]/*", | |
| "nextLink":"id(\"mod-pagination\")//span[@class=\"next_url\"][last()]/a", | |
| "wedata.net.id":35039 | |
| }, | |
| { | |
| "url":"^http://www\\.hentaicore\\.net/", | |
| "pageElement":"id(\"column\")/div[contains(@class,\"post\")]", | |
| "nextLink":"//li[@class=\"paginav-next\"]/a", | |
| "wedata.net.id":76247 | |
| }, | |
| { | |
| "url":"^http://news\\.yahoo\\.co\\.jp/", | |
| "pageElement":"//ul[starts-with(@class,\"list\")]", | |
| "nextLink":"//li[@class=\"next\"]/a", | |
| "wedata.net.id":74997 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?7fonts\\.ru/", | |
| "pageElement":"//dl[@class='download']/*", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":61441 | |
| }, | |
| { | |
| "url":"^http://c\\.filesend\\.to/plans", | |
| "pageElement":"id(\"plans\")//div[@class=\"body\"]|//div[@class=\"title\"][//td[@class=\"page\"]/span/text()=1]", | |
| "nextLink":"//a[@class='next']|//ul[@class='backnumber']/li[a[contains(@href,concat('body.php?od=20',substring-after(//div[@class='bar_navi']//a[contains(@href,'b.hatena')]/@href,'20')))]]/following-sibling::li[1]/a", | |
| "wedata.net.id":77008 | |
| }, | |
| { | |
| "url":"^http://[^/]+\\.hkgolden\\.com/", | |
| "pageElement":"id('ctl00_ContentPlaceHolder1_view_form')/div/table[.//*[starts-with(@id,'ThreadUser')]]|id('mainTopicTable')//tr[td/img]|//tr[td/table[contains(@id,'ctl00_ContentPlaceHolder1')]]", | |
| "nextLink":"//a[.//text()='下一頁']", | |
| "wedata.net.id":74994 | |
| }, | |
| { | |
| "url":"^http://[^.]+\\.iusethis\\.com/", | |
| "pageElement":"//div[@class=\"individualapps\" or @class=\"recitem\" or @class=\"comment\"]", | |
| "nextLink":"id(\"pagenr\")/span/following-sibling::a[1]", | |
| "wedata.net.id":652 | |
| }, | |
| { | |
| "url":"^http://sogap\\.cielquis\\.net/", | |
| "pageElement":"//div[@class=\"contents\"]/div[@class=\"contents-body\"]/div[starts-with(@class,'article ')]", | |
| "nextLink":"//a[@rel=\"next\"]|id(\"contents-navigator-bottom\")/ul/li/a", | |
| "wedata.net.id":60494 | |
| }, | |
| { | |
| "url":"^http://www\\.geek-pages\\.com/", | |
| "pageElement":"//table[@class=\"contentpaneopen\"]/tbody//p", | |
| "nextLink":"//a[starts-with(text(), \"Next\")]", | |
| "wedata.net.id":30671 | |
| }, | |
| { | |
| "url":"^http://www\\.kitajirushi\\.jp/", | |
| "pageElement":"id(\"entries-inner\")/div[@class=\"entrypaper\"]/div[not(@class=\"trackbacks\")][not(./form)]|id(\"comments\")/div", | |
| "nextLink":"//p[@class=\"first\"]/following-sibling::node()/a[1][not(@href=\"http://www.kitajirushi.jp/\")]|//a[@rel=\"next\"]", | |
| "wedata.net.id":74986 | |
| }, | |
| { | |
| "url":"^http://www\\.funnysigns\\.net/", | |
| "pageElement":"//div[@class='categoryPost']|//h2[@class='moreSigns']/preceding-sibling::div", | |
| "nextLink":"//a[@class='nextpostslink' or @class='nextPost']", | |
| "wedata.net.id":74985 | |
| }, | |
| { | |
| "url":"^http://ranking\\.cosme\\.net/.", | |
| "pageElement":"id('list-item')/*", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":30675 | |
| }, | |
| { | |
| "url":"^http://www\\.metafilter\\.com/", | |
| "pageElement":"//p[@class='copy']/preceding-sibling::*", | |
| "nextLink":"//p[@class='copy']/a[.='Older posts']", | |
| "wedata.net.id":29247 | |
| }, | |
| { | |
| "url":"^https://www\\.search\\.com/web", | |
| "pageElement":"//div[@class='l-web-results']/div[@class='web-result']", | |
| "nextLink":"//a[@class='show-more-button']", | |
| "wedata.net.id":64749 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?yaplog\\.jp/", | |
| "pageElement":"//div[@class=\"entry\"]|//div[@class=\"new_up_box\"]/ul[@class=\"clearfix\"]/li|//table/tbody/tr[2]/td/h1|//div[@class=\"c_fence\"]", | |
| "nextLink":"//ul[starts-with(@class,\"page\")]/li[last()]/a|//p[@class=\"pager\"]/a[last()]|//li[@class=\"last\"]/a", | |
| "wedata.net.id":694 | |
| }, | |
| { | |
| "url":"^https?://gree\\.jp/¥?mode=home", | |
| "pageElement":"//*[@id=\"-stream\"]|//*[@id=\"home-stream\"]", | |
| "nextLink":"//*[@id=\"stream-footer\"]/a", | |
| "wedata.net.id":36264 | |
| }, | |
| { | |
| "url":"^http://shotworks\\.jp/sw/list/", | |
| "pageElement":"id('list')/div[starts-with(@class,'workinfo')]", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":64768 | |
| }, | |
| { | |
| "url":"^http://variety(latino)?\\.com/", | |
| "pageElement":"//div[@class='col1']/section[starts-with(@class,'module-blogroll')]", | |
| "nextLink":"//div[@class='pagination more-news']/a|//li[@class='next']/a|//a[@class='next page-numbers']", | |
| "wedata.net.id":76290 | |
| }, | |
| { | |
| "url":"^http://arubaito-ex\\.jp/search", | |
| "pageElement":"//div[@class='joblist']/*", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":64772 | |
| }, | |
| { | |
| "url":"^http://r\\.gnavi\\.co\\.jp/sp/", | |
| "pageElement":"//div[@class='shop_list']/section|id('searchList')/li", | |
| "nextLink":"//a[@class='next']|//li[span/@class='now']/following::li[1]/a", | |
| "wedata.net.id":30753 | |
| }, | |
| { | |
| "url":"^http://ngc\\.sherry\\.jp/list/", | |
| "pageElement":"//div[@align=\"center\"][1]/following-sibling::table", | |
| "nextLink":"//div[@align=\"center\"][count(./a)>1 or ./a[@href=\"list2.html\"]]/a[last()]", | |
| "wedata.net.id":33232 | |
| }, | |
| { | |
| "url":"^http://portal\\.nifty\\.com/20", | |
| "pageElement":"//td[@width=\"540\" or @width=\"640\" or @width=\"600\"][@align=\"center\"]/*", | |
| "nextLink":"//a[contains(text(), \">\")]", | |
| "wedata.net.id":728 | |
| }, | |
| { | |
| "url":"^http://search\\.takamiya\\.jp/", | |
| "pageElement":"id('searchList')/tbody/tr", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":26563 | |
| }, | |
| { | |
| "url":"^http://www\\.conveniice\\.com/", | |
| "pageElement":"id(\"main_contents\")/*", | |
| "nextLink":"id(\"main_contents\")//p[@class=\"previous_post\"]/a", | |
| "wedata.net.id":64844 | |
| }, | |
| { | |
| "url":"^http://myfirstclasslife\\.com/", | |
| "pageElement":"//div[@class='wpb_row row-fluid']", | |
| "nextLink":"//a[img/@class='td-retina right-arrow']", | |
| "wedata.net.id":80813 | |
| }, | |
| { | |
| "url":"^http://www\\.eroprofile\\.com/", | |
| "pageElement":"//*[@id=\"pageRight\"]/div/div[@class=\"box\"]/div[@class=\"boxCnt\"]/table/tbody/tr | //div[@id=\"pageRight\"] ", | |
| "nextLink":"//a[span/@class=\"sprIco16_73\"]", | |
| "wedata.net.id":77496 | |
| }, | |
| { | |
| "url":"^http://www\\.wcxsw\\.com/book/", | |
| "pageElement":"id('contents')", | |
| "nextLink":"id(\"footlink\")/a[last()]", | |
| "wedata.net.id":76953 | |
| }, | |
| { | |
| "url":"^http://fiancetank\\.net/nano3/", | |
| "pageElement":"//div[@class=\"entry\"]", | |
| "nextLink":"//a[@class=\"link_next\"] | //link[@rel=\"prev\" and number(substring(substring-after(@href, \"/nano3/\"), 0, 5))]", | |
| "wedata.net.id":64926 | |
| }, | |
| { | |
| "url":"^http://atlantablackstar\\.com/", | |
| "pageElement":"id('content')/div[h2/@class='entry-title']|//div[@class='entry-content'][id('paginate-link')]/*[not(@class='pages')]", | |
| "nextLink":"//li[@class='pagination-next']/a|id('next-post-page')/a[div/@class='alignright']", | |
| "wedata.net.id":76919 | |
| }, | |
| { | |
| "url":"^http://www\\.wnacg\\.(com|org)", | |
| "pageElement":"//div[@class=\"gallary_wrap\"] | //img[@id=\"picarea\"]", | |
| "nextLink":"//span[@class=\"next\"]/a | //a[@class=\"btntuzao\"][.=\"下一頁\"]", | |
| "wedata.net.id":80799 | |
| }, | |
| { | |
| "url":"^http://bookcoverarchive\\.com/", | |
| "pageElement":"//section", | |
| "nextLink":"//span[@class='page-numbers current']/following-sibling::a[1]", | |
| "wedata.net.id":26621 | |
| }, | |
| { | |
| "url":"^https://www\\.barks\\.jp/news/", | |
| "pageElement":"//section[@class='article-body']|id('NewsLists')/*[not(@class='sort-btns btn-general' or @class='page-navi')]", | |
| "nextLink":"//a[@class='page-arrow page-next']", | |
| "wedata.net.id":77203 | |
| }, | |
| { | |
| "url":"^http://www\\.marktplaats\\.nl/", | |
| "pageElement":"//section[@class='search-results-table table']/*", | |
| "nextLink":"//a[contains(@class,'pagination-next')]", | |
| "wedata.net.id":65329 | |
| }, | |
| { | |
| "url":"^http://www\\.movie-blog\\.org/", | |
| "pageElement":"//div[@class='beitrag2']", | |
| "nextLink":"//a[@class='nextpostslink']", | |
| "wedata.net.id":76897 | |
| }, | |
| { | |
| "url":"^.+://[^/]+\\.tumblr\\.com/.*.*", | |
| "insertBefore":"//*[contains(concat(' ',@class,' '), ' autopagerize_insert_before ')]", | |
| "pageElement":"//*[contains(concat(' ',@class,' '), ' autopagerize_page_element ')]", | |
| "nextLink":"(//a|//link)[@rel='next']", | |
| "wedata.net.id":31158 | |
| }, | |
| { | |
| "url":"^http://marine\\.shop-pro\\.jp/", | |
| "pageElement":"//div[@class=\"category_items\"]", | |
| "nextLink":"//a[img[@alt=\"次のページ\"]]", | |
| "wedata.net.id":65368 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?piapro\\.jp/", | |
| "pageElement":"//*[@id=\"itemcont\" or @class=\"txt_list\" or @class=\"snd_list\"]", | |
| "nextLink":"id(\"_paginator\")//td[span/strong]/following-sibling::td/span/a", | |
| "wedata.net.id":1227 | |
| }, | |
| { | |
| "url":"^http://www\\.ohzora\\.co\\.jp/", | |
| "pageElement":"//div[@class='sn' or @class='wgroup']", | |
| "nextLink":"//p[@class=\"left\"]/strong/following-sibling::a[1]", | |
| "wedata.net.id":65369 | |
| }, | |
| { | |
| "url":"^https?://www\\.jazykovky\\.cz/", | |
| "pageElement":"//div[@class='skola-item tablerow']", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":55929 | |
| }, | |
| { | |
| "url":"^http://[^./]+\\.playno1\\.com/", | |
| "pageElement":"id(\"ct\")/div[@class=\"mn\"]/div[contains(@class,\"bm\")]/div", | |
| "nextLink":"//div[@class=\"pg\"]/strong/following-sibling::a", | |
| "wedata.net.id":65414 | |
| }, | |
| { | |
| "url":"^http://www\\.cinematoday\\.jp/", | |
| "pageElement":"id(\"news-detail\")/ul[@class=\"prev_next\"][1]/following-sibling::*[following-sibling::div[@style][./ul[@class=\"links\"]]][not(@class=\"ct-pagenation\")]|//h1[@itemprop=\"name\"]|//div[@class=\"item\"]", | |
| "nextLink":"id(\"contents\")//span[@class=\"pager-next\"]/a|id(\"contents\")//div[contains(@style,\"text-align:center\")]/a[1][contains(@href,\"date\")]|//li[@class=\"ct-next\"]/a|id(\"news-detail\")//ul[@class=\"prev_next\"][last()]/li[1]/a", | |
| "wedata.net.id":65467 | |
| }, | |
| { | |
| "url":"^http://hints\\.macworld\\.com/", | |
| "pageElement":"//div[@class='story']", | |
| "nextLink":"//div[@class='pagenav']/b/following-sibling::a[1]", | |
| "wedata.net.id":1573 | |
| }, | |
| { | |
| "url":"http://dou-navi.net/page.php?.+", | |
| "pageElement":"//p[@class='book']", | |
| "nextLink":".//li//a[contains(./text(),'次')]", | |
| "wedata.net.id":76859 | |
| }, | |
| { | |
| "url":"^http://quanben-xiaoshuo\\.com/", | |
| "pageElement":"id('articlebody')/*", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":77215 | |
| }, | |
| { | |
| "url":"^https?://minne\\.com/category/", | |
| "pageElement":"//ul[@class=\"item_list\"]/li", | |
| "nextLink":"//a[@rel=\"next\" and @data-tracking-action=\"次\"]", | |
| "wedata.net.id":76843 | |
| }, | |
| { | |
| "url":"^http://www\\.aliexpress\\.com/", | |
| "pageElement":"//div[contains(@id,'list-items')]/ul", | |
| "nextLink":"//a[@class='page-next ui-pagination-next']", | |
| "wedata.net.id":65652 | |
| }, | |
| { | |
| "url":"^http://www\\.toriikengo\\.com/", | |
| "pageElement":"id(\"ts-fab-below\")/preceding-sibling::*|//article/header", | |
| "nextLink":"id(\"prev\")", | |
| "wedata.net.id":76831 | |
| }, | |
| { | |
| "url":"^http://news\\.yahoo\\.co\\.jp/", | |
| "pageElement":"//li[@class='article']", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":65670 | |
| }, | |
| { | |
| "url":"^http://yaneuraou\\.yaneu\\.com", | |
| "pageElement":"id(\"content\")", | |
| "nextLink":"//link[@rel=\"prev\"]", | |
| "wedata.net.id":76807 | |
| }, | |
| { | |
| "url":"^http://www\\.pricefinder\\.ca/", | |
| "pageElement":"//table[@class='table table-striped']/tbody/tr", | |
| "nextLink":"//a[span.='»']", | |
| "wedata.net.id":74880 | |
| }, | |
| { | |
| "url":"^http://hatenanews\\.com/mobile", | |
| "pageElement":"//a[@accesskey='6']/../../preceding-sibling::div[position()!=last()][a]", | |
| "nextLink":"//a[@accesskey='6']", | |
| "wedata.net.id":55505 | |
| }, | |
| { | |
| "url":"^https://apps\\.owncloud\\.com/", | |
| "pageElement":"//tr[contains(@class,'listview') or td/@class='listviewspacer']|//table[@class='commentbox']/ancestor::table[1]|//table[@class='commentbox']/ancestor::table[1]/following-sibling::br[1]", | |
| "nextLink":"//span[@class='pagerbutton2']/a", | |
| "wedata.net.id":80684 | |
| }, | |
| { | |
| "url":"^http://www\\.thegootube\\.com/", | |
| "pageElement":"//td[a[contains(concat(' ', @class, ' '), ' link ')]]/table", | |
| "nextLink":"//*[contains(concat(' ', @class, ' '), ' actual_page ')]/following-sibling::a[1]", | |
| "wedata.net.id":66813 | |
| }, | |
| { | |
| "url":"^http://www\\.wiggle\\.co\\.uk/", | |
| "pageElement":"id('search-results')/div", | |
| "nextLink":"//a[@class='bem-paginator__link js-nav-ajax'][.='>']", | |
| "wedata.net.id":39225 | |
| }, | |
| { | |
| "url":"^http://www\\.avenew\\.jp/blog/", | |
| "pageElement":"id(\"content\")/div[@class!=\"navigation\"]", | |
| "nextLink":"id(\"content\")//div[@class=\"navigation\"]/div[@class=\"alignright\"]/a", | |
| "wedata.net.id":31826 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?cfake\\.com/", | |
| "pageElement":"//tr[./td[@class=\"cfakeLine\"]]", | |
| "nextLink":"id(\"pageTDselect\")/following-sibling::td[1]/a", | |
| "wedata.net.id":32994 | |
| }, | |
| { | |
| "url":"^http://www\\.carandbike\\.com/", | |
| "pageElement":"//ul[@class='list-view']/li|id('news-result')/div[@class='grid_8']|//div[@class='row row-g_30' and .//div/@class='row row-g_30' or @class='item grid_6']", | |
| "nextLink":"//li[@class='page selected']/following-sibling::li[1]/a", | |
| "wedata.net.id":80564 | |
| }, | |
| { | |
| "url":"^http://www\\.goallegacy\\.net/", | |
| "pageElement":"//ul[@class='topiclist topics bg_none']|id('main')//div[contains(@id,'p') and contains(@class,'post row') and div/@class='inner']", | |
| "nextLink":"//a[contains(img/@alt,\"Next\")]", | |
| "wedata.net.id":67257 | |
| }, | |
| { | |
| "url":"^http://boards\\.barachan\\.org", | |
| "pageElement":"//div[contains(@id,\"thread_\")]", | |
| "nextLink":"//a[@class=\"selected\"]/following-sibling::a[1]", | |
| "wedata.net.id":80562 | |
| }, | |
| { | |
| "url":"^http://zeak\\.air-nifty\\.com/", | |
| "pageElement":"//div[@class=\"entry\"]", | |
| "nextLink":"//div[@class=\"entry-nav\"]//a[1]", | |
| "wedata.net.id":27982 | |
| }, | |
| { | |
| "url":"^http://blog\\.techichi\\.jp/.+", | |
| "pageElement":"id('article')/*|(id('shop-contents')|//div[@class='list'])/ul/li", | |
| "nextLink":"//a[@class='next page-numbers']", | |
| "wedata.net.id":70094 | |
| }, | |
| { | |
| "url":"^http://www\\.monotaro\\.com/s/", | |
| "pageElement":"id(\"items_wrapper\")", | |
| "nextLink":"//p[@class=\"citem_pager\"]/a[@class=\"page_next\"]", | |
| "wedata.net.id":54445 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?c-faq\\.com/", | |
| "insertBefore":"//hr[last()]", | |
| "pageElement":"(//html/body/node() | //html/node())[preceding-sibling::hr and following-sibling::hr]", | |
| "nextLink":"//a[img[@alt=\"next\"]]", | |
| "wedata.net.id":27721 | |
| }, | |
| { | |
| "url":"^https?://[^.]+\\.backlog\\.jp/", | |
| "insertBefore":"//table[@class=\"pager\"][2]", | |
| "pageElement":"id(\"issues-table\")", | |
| "nextLink":"id(\"pager-next\")", | |
| "wedata.net.id":1958 | |
| }, | |
| { | |
| "url":"^http://www\\.aceshowbiz\\.com/", | |
| "pageElement":"//ul[@class='blog big']/li|//div[@class='post single']/table//tr[not(@class='header')]|//div[@class='row page_margin_top']/div[@class='row']", | |
| "nextLink":"//ul[starts-with(@class,'pagination')]/li[@class='right']/a|//div[@class='button blue']/following-sibling::a[1]|//div[@class='tcenter'][.//a[@class='button']]//h3/text()[string-length(normalize-space()) > 0]/following-sibling::a[1]", | |
| "wedata.net.id":79962 | |
| }, | |
| { | |
| "url":"^http://wegotthiscovered\\.com/", | |
| "pageElement":"id('post_content')/div/*[preceding-sibling::div/@class='post_pagination top-pagination'][following-sibling::div/@class='post_pagination']", | |
| "nextLink":"//a[span/@class='next']", | |
| "wedata.net.id":77427 | |
| }, | |
| { | |
| "url":"^https?://www\\.dpreview\\.com/", | |
| "pageElement":"//div[@class='articleBody' or @class='articles' or @class='threadPostList']/*|id('forumsThreadList')/tbody/tr", | |
| "nextLink":"//*[@class='next' or @class='next enabled']/a", | |
| "wedata.net.id":76356 | |
| }, | |
| { | |
| "url":"^http://www\\.popmatters\\.com/", | |
| "pageElement":"//div[@class='recentlist' or @class='BlogPostEntries clearfix']|//div[@class='review-article clearfix']/*[following-sibling::div/div/@class='PageNavigationContainer PageNavigationContainerTop']", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":76655 | |
| }, | |
| { | |
| "url":"^http://jigadori\\.fkoji\\.com/", | |
| "pageElement":"//*[@id=\"wrapper\"]", | |
| "nextLink":"//*[@id=\"wrapper\"]/p[3]/a", | |
| "wedata.net.id":74815 | |
| }, | |
| { | |
| "url":"^https://www\\.shop\\.bt\\.com/", | |
| "pageElement":"//table[@class='product-listing']//tr[td]", | |
| "nextLink":"//a[@title='Next'][./following-sibling::img[@alt='Next']]", | |
| "wedata.net.id":77860 | |
| }, | |
| { | |
| "url":"^http://manga-style\\.jp/press/", | |
| "pageElement":"//div[contains(concat(' ',normalize-space(@class),' '),' hentry ')]", | |
| "nextLink":"//div[@class='page-numbers']/span/following-sibling::a|//link[@rel='prev'][not(//div[@class=\"page-numbers\"]/span/following-sibling::a)]", | |
| "wedata.net.id":76360 | |
| }, | |
| { | |
| "url":"^http://www\\.travel\\.co\\.jp/", | |
| "pageElement":"//div[@class='resultList resultNormal']/div", | |
| "nextLink":"//a[@class='next pager-link']", | |
| "wedata.net.id":32832 | |
| }, | |
| { | |
| "url":"^http://www\\.themarysue\\.com/", | |
| "pageElement":"id('chron-posts')/div", | |
| "nextLink":"//span[@class='alignleft']/a", | |
| "wedata.net.id":77658 | |
| }, | |
| { | |
| "url":"^http://himasoku\\.com/archives", | |
| "pageElement":"//div[@class=\"article-body entry-content\"]//div[@class=\"dashed\"]/following-sibling::*[following-sibling::a[@name=\"more\"]]|//div[@class=\"article-body-more\"]//span[@id][count(./dd/span)=1][not(./dd/span/span)]|//div[@class=\"article-body-more\"]//span[@id][last()]/dt|//div[@class=\"article-body-more\"]//span[@id][last()]/dd/span[1][not(./span)]|//div[@class=\"article-body-more\"]//span[@id][last()]/dd/span/span/preceding-sibling::node()|//div[@class=\"article-body-more\"]//div[contains(@class,\"t_h\")]|//div[@class=\"article-body-more\"]//div[contains(@class,\"t_b\")][not(./span) or ./span[@class=\"anchor\"]]|//div[@class=\"article-body-more\"]//div[contains(@class,\"t_b\")][last()]|//div[@class=\"article-header\"]|//ul[@class=\"comment-info\"]|//a[@name=\"comment_area\"]/following-sibling::*[following-sibling::script]", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":76366 | |
| }, | |
| { | |
| "url":"^http://bakery\\.cakephp\\.org/", | |
| "pageElement":"//div[@class='body'/*]", | |
| "nextLink":"//a[@accesskey='N']", | |
| "wedata.net.id":27653 | |
| }, | |
| { | |
| "url":"^http://www\\.office-cue\\.com/", | |
| "pageElement":"id(\"layout-popup\")/div[@id=\"main\"]/* | id(\"layout-three-inn\")//div[@class=\"chapter\" and not(@id=\"page_navi\")]", | |
| "nextLink":"//span[@class=\"pageNext\"]/a", | |
| "wedata.net.id":72645 | |
| }, | |
| { | |
| "url":"^http://www\\.cheatsheet\\.com/", | |
| "pageElement":"//article[@class='article']/section|//ul/li[@class='media-list__item'][.//a]", | |
| "nextLink":"//a[starts-with(*/@class,'next-btn') or @class='next page-numbers']", | |
| "wedata.net.id":74735 | |
| }, | |
| { | |
| "url":"^http://welovetypography\\.com/", | |
| "pageElement":"id('images')/li", | |
| "nextLink":"//a[@class='last']", | |
| "wedata.net.id":32802 | |
| }, | |
| { | |
| "url":"^http://kichiku-doujinko\\.com/", | |
| "pageElement":"//div[@id=\"doujinshiList\"]", | |
| "nextLink":"//Nav[@id=\"pageNav\"]//a[last()]", | |
| "wedata.net.id":72690 | |
| }, | |
| { | |
| "url":"^http://dic\\.nicovideo\\.jp/t/", | |
| "pageElement":"id('bbs_wrapper')", | |
| "nextLink":"//div[@class=\"pager\"]/a[last()][not(./following-sibling::span[@class=\"current\"])]", | |
| "wedata.net.id":77426 | |
| }, | |
| { | |
| "url":"^http://dlsoft\\.dmm\\.co\\.jp/", | |
| "pageElement":"id(\"headlist\")/p", | |
| "nextLink":"id(\"headlist\")/div/dl/dd/ul/li[not(a)]/following-sibling::li/a", | |
| "wedata.net.id":40582 | |
| }, | |
| { | |
| "url":"^http://holykaw\\.alltop\\.com/", | |
| "pageElement":"//div[@class='row-fluid row-featured']", | |
| "nextLink":"//a[div/@class='span5 pagination-anchor next']", | |
| "wedata.net.id":77693 | |
| }, | |
| { | |
| "url":"^http://yonezon\\.coresv\\.com/", | |
| "pageElement":"//div[@class=\"art\"]", | |
| "nextLink":"//ul[@class=\"pager\"]/li[last()]/a", | |
| "wedata.net.id":77425 | |
| }, | |
| { | |
| "url":"^http://([^/]+\\.)?slate\\.com/", | |
| "pageElement":"//div[@class='page-container']/*|//p[@class='load-more-button']/preceding-sibling::*", | |
| "nextLink":"//*[@class='next' or @class='load-more-button']/a", | |
| "wedata.net.id":32367 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?nitroplus\\.", | |
| "pageElement":"//center/table[@bgcolor]|id('main')/*[self::div[contains(@class,'article')] or self::p[contains(@class,'backtop')]]|id('products-list')/li", | |
| "nextLink":"//a[.='next>>' or @class='next i-next']|//span[@class='current_page']/following-sibling::a[1]|id('localNav')/ul/li/a", | |
| "wedata.net.id":53764 | |
| }, | |
| { | |
| "url":"^https?://.*search\\.yahoo\\.co", | |
| "pageElement":"id(\"web resultsWrapper\")/ol", | |
| "nextLink":"//a[@rel=\"next\" or @id=\"pg-next\"]", | |
| "wedata.net.id":53728 | |
| }, | |
| { | |
| "url":"^http://.+\\.daum\\.net/search/", | |
| "pageElement":"//ul[@class='list_register']/li", | |
| "nextLink":"//a[@class='ico_btn btn_next']", | |
| "wedata.net.id":53709 | |
| }, | |
| { | |
| "url":"^http://imageboard\\.xrea\\.jp/", | |
| "pageElement":"//form[contains(.,'画像タイトル')]/node()[following::input/@value='削除']", | |
| "nextLink":"descendant::form[last()]", | |
| "wedata.net.id":53676 | |
| }, | |
| { | |
| "url":"^http://jp\\.apps\\.gree\\.net/", | |
| "pageElement":"//ul[@class=\"row rowIbHrz\"][//link[@rel=\"canonical\"][contains(@href,\"list\")]]/li|//div[@class=\"row\"][//link[@rel=\"canonical\"][contains(@href,\"search\")]]", | |
| "nextLink":"//li[@class=\"cur\"]/following-sibling::li[1]/a", | |
| "wedata.net.id":77836 | |
| }, | |
| { | |
| "url":"^http://www\\.katsumaweb\\.com/", | |
| "pageElement":"//div[@class=\"news_detail\"]", | |
| "nextLink":"//a[@title=\"next page\"]", | |
| "wedata.net.id":77694 | |
| }, | |
| { | |
| "url":"^http://www\\.piaotian\\.net/.+", | |
| "pageElement":"id('content')", | |
| "nextLink":"//div[@id=\"thumb\"]/a[2]", | |
| "wedata.net.id":77695 | |
| }, | |
| { | |
| "url":"^http://brightkite\\.com/search", | |
| "pageElement":"//div[@class='listings']", | |
| "nextLink":"//li[@class='active']/following-sibling::li[1]/a", | |
| "wedata.net.id":27535 | |
| }, | |
| { | |
| "url":"^http://www\\.goodsearch\\.com/", | |
| "pageElement":"id('web')//li", | |
| "nextLink":"id('pg-next')", | |
| "wedata.net.id":32419 | |
| }, | |
| { | |
| "url":"^http://www\\.zcool\\.com\\.cn/", | |
| "pageElement":"//ul[@class='layout camWholeBoxUl']|//div[@class='bigPage pt30 pb20 vm center']/preceding-sibling::*|id('resultlistul')/li[.//img]|//div[@class='upJyBox']//li", | |
| "nextLink":"//a[@class='pageNext'][@href]", | |
| "wedata.net.id":73808 | |
| }, | |
| { | |
| "url":"^http://www\\.girlsdocam\\.com/", | |
| "pageElement":"//div[@class=\\\"cont\\\"]/div[@class=\\\"items\\\"]/ul/li", | |
| "nextLink":"//ul[@class=\\\"pages\\\"]/li[last()]/a | //a[contains(text(), \\\"next page\\\")]", | |
| "wedata.net.id":77419 | |
| }, | |
| { | |
| "url":"^http://rss\\.r401\\.net/yaruo/", | |
| "pageElement":"(//div[@class='entry']/div[span/a]/preceding-sibling::*|//article[@class=\"post\"]/h2)[not(//div/@class='navigation')]|//article[@class='post'][//div/@class='navigation']", | |
| "nextLink":"//span/a[contains(.,concat(number(substring-before(substring-after(//article/div/h3[2],'月'),'日'))-1,'日'))]|//span/a[contains(.,concat(number(substring-before(substring-after(//article[@class='post']/h2/text(),'月'),'日'))-1,'日'))]|//span/a[contains(text(),concat(number(substring-before(substring-after(//article[@class='post']/h2/text(),'年'),'月'))-1,'月'))]|//div/a[@class='next']", | |
| "wedata.net.id":52784 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?crash\\.net/", | |
| "pageElement":"id(\"articleContent\")|//ul[@class='shedule-list']/li", | |
| "nextLink":"id(\"masterContent_pageContent_hypNextPage\")|//a[starts-with(@id,'NextPage')]", | |
| "wedata.net.id":52629 | |
| }, | |
| { | |
| "url":"^https://www\\.winandmac\\.com/", | |
| "pageElement":"//div[@class='panel-wrapper clearfix']|//br[@class='clearer']", | |
| "nextLink":"//link[@rel='next']", | |
| "wedata.net.id":73845 | |
| }, | |
| { | |
| "url":"^http://oryouri\\.2chblog\\.jp/", | |
| "pageElement":"//div[@class='article-outer hentry']", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":76383 | |
| }, | |
| { | |
| "url":"^http://ism\\.excite\\.co\\.jp/", | |
| "pageElement":"//div[@class='content_detail']", | |
| "nextLink":"//li[@class='next PRO0']/a", | |
| "wedata.net.id":50742 | |
| }, | |
| { | |
| "url":"^http://www\\.channel-ai\\.com/", | |
| "pageElement":"(id(\"bodyline\")/form/table|id(\"bodyline\")/table[@class=\"viewtopic\"])/tbody/tr[@class=\"toplines\"]/following-sibling::tr[position()<last()]", | |
| "nextLink":"id(\"bodyline\")/div[@class=\"bottombuttons\"]//a[contains(., \"Next\")]|id(\"content\")/div[@class=\"wp-pagenavi\"]/a[@class=\"nextpostslink\"]", | |
| "wedata.net.id":32719 | |
| }, | |
| { | |
| "url":"^http://www\\.pornative\\.com.+", | |
| "pageElement":"//div[@class=\"smallmovie\"]", | |
| "nextLink":"//a[contains(text(), \"Next\")]", | |
| "wedata.net.id":50496 | |
| }, | |
| { | |
| "url":"^http://www\\.dreamstime\\.com/", | |
| "pageElement":"//div[@class='thb_cell thb_cell_v1']", | |
| "nextLink":"//a[@class='dt-results-next']", | |
| "wedata.net.id":32473 | |
| }, | |
| { | |
| "url":"^http://www\\.allyoulike\\.com/", | |
| "pageElement":"//div[@class='post']", | |
| "nextLink":"//span[@class='this-page']/following-sibling::a[1]", | |
| "wedata.net.id":77365 | |
| }, | |
| { | |
| "url":"^http://haruka-yumenoato\\.net/", | |
| "pageElement":"//div[@class='common-article-list']", | |
| "nextLink":"//a[text()='次へ']", | |
| "wedata.net.id":74066 | |
| }, | |
| { | |
| "url":"^http://www\\.czech[^.]+\\.com/", | |
| "pageElement":"//div[@class=\"welcome inner\"]/following-sibling::*[following::div[@class=\"bonussites\"]]", | |
| "nextLink":"//a[@class=\"button btB\"]", | |
| "wedata.net.id":77699 | |
| }, | |
| { | |
| "url":"^http://search\\.4shared\\.com/", | |
| "pageElement":"//div[@class=\"fsize\"]/ancestor::table[1]", | |
| "nextLink":"//td[@class=\"pagerOn\"]/following-sibling::td[1]/a", | |
| "wedata.net.id":32499 | |
| }, | |
| { | |
| "url":"^http://tumblr\\.samai\\.net/.*", | |
| "pageElement":"//*[count(*[.//a[@class='permalink' or img/@class='permalink' or ../@class='date' or contains(@title,'permalink') or @class='fecha' or contains(@href,'/post/')]| .//div[contains(concat(' ',normalize-space(@class),' '),' permalink ')]/a])>=4]/*[.//a[@class='permalink' or img/@class='permalink' or ../@class='date' or contains(@title,'permalink') or @class='fecha' or contains(@href,'/post/')] | .//div[contains(concat(' ',normalize-space(@class),' '),' permalink ')]/a]", | |
| "nextLink":"//a[contains(@href,'/page/')][number(substring-after(self::a/@href,'/page/'))-number(substring-after(preceding::a[contains(@href,'/page/')][1]/@href,'/page/')) = 2 or number(substring-after(self::a/@href,'/page/'))-number(substring-after(following::a[contains(@href,'/page/')][1]/@href,'/page/')) = 2]|//a[starts-with(@href,'/page/') or contains(@href,'/search/') or contains(@href,'/tagged/')][contains(@href,'/page/2')][number(substring-after(following::a[contains(@href,'/page/')][1]/@href,'/page/')) != 4 and number(substring-after(preceding::a[contains(@href,'/page/')][1]/@href,'/page/')) != 4]", | |
| "wedata.net.id":74247 | |
| }, | |
| { | |
| "url":"^http://www\\.treehugger\\.com/", | |
| "pageElement":"id('stream-item-list')//li[p]", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":32700 | |
| }, | |
| { | |
| "url":"^http://www\\.gutefrage\\.net/.", | |
| "pageElement":"(//ul[@class='QuestionListing' or @class='AnswerTeaser-list']|id('userListTopUser'))/li", | |
| "nextLink":"//a[@class='Paginator-button Paginator-buttonNext' or @class='next browse right']", | |
| "wedata.net.id":32502 | |
| }, | |
| { | |
| "url":"^http://discoverabug\\.com/bugs", | |
| "pageElement":"//a[@class='buglink']", | |
| "nextLink":"//li[@class='active']/following-sibling::li[1]/a", | |
| "wedata.net.id":74362 | |
| }, | |
| { | |
| "url":"^http://www\\.advertimes\\.com/", | |
| "pageElement":"//div[@class=\"page-links\"]/preceding-sibling::a[1]/preceding-sibling::*|//div[@class=\"page-links\"][not(./preceding-sibling::a)]/preceding-sibling::*", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":47200 | |
| }, | |
| { | |
| "url":"^http://ihc\\.monotaro\\.com/c/", | |
| "pageElement":"id(\"contents_main\")/div[@class=\"contents_main_box\"]", | |
| "nextLink":"id(\"contents_main\")/div[@class=\"page\"]/a[contains(text(),\">>\")]", | |
| "wedata.net.id":76410 | |
| }, | |
| { | |
| "url":"^http://www\\.imagesetdb\\.com/", | |
| "pageElement":"id(\"content\")/div[contains(concat(\" \", @class, \" \"), \" thumb \")]", | |
| "nextLink":"id(\"wp_page_numbers\")//a[text()=\">\"]", | |
| "wedata.net.id":46690 | |
| }, | |
| { | |
| "url":"^http://www\\.japanprobe\\.com/", | |
| "pageElement":"id(\"content\")/div[not(@class=\"post-nav\")]", | |
| "nextLink":"id(\"content\")/div[@class=\"post-nav\"]/p/a[contains(., \"\u00bb\")]", | |
| "wedata.net.id":2206 | |
| }, | |
| { | |
| "url":"^https://.+\\.secondlife\\.com/", | |
| "pageElement":"id('messageList')//tr[td]|//div[starts-with(@id,'messageview')]", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":2219 | |
| }, | |
| { | |
| "url":"^http://alphavilleherald\\.com/", | |
| "pageElement":"id(\"latest\")/div[@class=\"more_entries\"]/preceding-sibling::div", | |
| "nextLink":"id(\"latest\")/div[@class=\"more_entries\"]//a[contains(text(), \"Older\")]", | |
| "wedata.net.id":2226 | |
| }, | |
| { | |
| "url":"^https://www\\.thestreet\\.com/", | |
| "pageElement":"//div[@class='article__body']/*", | |
| "nextLink":"//link[@rel='next']", | |
| "wedata.net.id":76451 | |
| }, | |
| { | |
| "url":"^http://camgirlrecordings\\.com", | |
| "pageElement":"//div[@class=\"search_results_posts\"]|id(\"quickModForm\")", | |
| "nextLink":"//div[@class=\"pagesection\"]/span/strong/following-sibling::a[1]|//div[@class=\"pagelinks floatleft\"]/strong/following-sibling::a[1]", | |
| "wedata.net.id":77748 | |
| }, | |
| { | |
| "url":"^http://www\\.dgh\\.de/shop/de/", | |
| "pageElement":"//div[@class='itemsBox']", | |
| "nextLink":"//li[span/@class='piCurrent']/following-sibling::li[1]/a", | |
| "wedata.net.id":46310 | |
| }, | |
| { | |
| "url":"^http://www\\.kongregate\\.com/", | |
| "pageElement":"//div[@class='large_game_pod_column_one']/div[not(@class='adcontainer')]|//tr[@class='hentry' or @class='post hentry']", | |
| "nextLink":"//li[@class='next' or @class='next_link']/a", | |
| "wedata.net.id":32530 | |
| }, | |
| { | |
| "url":"^http://anal\\.sytes\\.net/bbs/", | |
| "pageElement":"//form[contains(text(), \"\u753b\u50cf\u30bf\u30a4\u30c8\u30eb\")]/node()[following::input[@value=\"\u524a\u9664\"]]", | |
| "nextLink":"descendant::form[last()]", | |
| "wedata.net.id":41435 | |
| }, | |
| { | |
| "url":"^http://www\\.siliconera\\.com/", | |
| "pageElement":"//div[@class='post']", | |
| "nextLink":"//div[@class='alignright']/p/a", | |
| "wedata.net.id":27366 | |
| }, | |
| { | |
| "url":"^http://www\\.orphanroad\\.com/", | |
| "pageElement":"id('post-teasers')/div[@class='post-teasers-row post-teasers-pair']", | |
| "nextLink":"//div[@class='pagination-next alignright']/a", | |
| "wedata.net.id":32581 | |
| }, | |
| { | |
| "url":"^http://stadt-bremerhaven\\.de/", | |
| "pageElement":"//div[@class='navigation']/preceding-sibling::*", | |
| "nextLink":"//a[@class='nextpostslink']", | |
| "wedata.net.id":32546 | |
| }, | |
| { | |
| "url":"^http://piyo\\.fc2\\.com/[^/]+/", | |
| "pageElement":"id(\"entry_body\")/div[@class=\"article\"]", | |
| "nextLink":"id(\"entry_body\")/div[@class=\"pager\"]/a[contains(text(), \"\u6b21\")]", | |
| "wedata.net.id":41459 | |
| }, | |
| { | |
| "url":"^http://www\\.soccer-king\\.jp/", | |
| "pageElement":"//ul[@class='paging']/preceding-sibling::node()", | |
| "nextLink":"//a[span='次へ']", | |
| "wedata.net.id":41481 | |
| }, | |
| { | |
| "url":"^http://news\\.discovery\\.com/", | |
| "pageElement":"//div[@class='editorial-body']/p[text()]", | |
| "nextLink":"//a[@class='button button-next ']", | |
| "wedata.net.id":27358 | |
| }, | |
| { | |
| "url":"^https://www\\.firstclass\\.cz/", | |
| "pageElement":"//div[@class='td-post-content']/div[contains(@class,'td-a-rec')]/preceding-sibling::*[number(substring-before(substring-after(substring-after(substring-after(substring-after(//link[@rel='canonical']/@href,'https://www.firstclass.cz/'),'/'),'/'),'/'),'/'))>1]|//article[@id]/*[not(self::footer)][not(number(substring-before(substring-after(substring-after(substring-after(substring-after(//link[@rel='canonical']/@href,'https://www.firstclass.cz/'),'/'),'/'),'/'),'/'))>1)]", | |
| "nextLink":"//a[@class='link-next']|//link[@rel='next'][not(//a/@class='link-next')]", | |
| "wedata.net.id":77708 | |
| }, | |
| { | |
| "url":"http://www\\.cinemablend\\.com/", | |
| "pageElement":"//div[@class='nextpage']/preceding-sibling::node()|//div[@class='partial content_story_topicheading ']/following-sibling::div/div[starts-with(@class,'story_item')]", | |
| "nextLink":"//div[@class='nextpage']/a|//a[@class='next']", | |
| "wedata.net.id":74662 | |
| }, | |
| { | |
| "url":"^http://www\\.elotrolado\\.net/", | |
| "pageElement":"id('forum-wrap')/*[starts-with(@class,'post ') or @class='divider']", | |
| "nextLink":"//link[@rel='next']", | |
| "wedata.net.id":27316 | |
| }, | |
| { | |
| "url":"^http://www\\.askul\\.co\\.jp/", | |
| "pageElement":"//table[@class='resultItemTable']/tbody/tr[td][not(@class='resultItemTableFooter')]", | |
| "nextLink":"//p[@class='next']/a", | |
| "wedata.net.id":29155 | |
| }, | |
| { | |
| "url":"^http://okguide\\.okwave\\.jp/", | |
| "pageElement":"//ul[@class='bace_lst bar_all']/li", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":34167 | |
| }, | |
| { | |
| "url":"^http://www\\.chuko\\.co\\.jp/", | |
| "pageElement":"id('list')", | |
| "nextLink":"//a[img/@alt='次へ']", | |
| "wedata.net.id":63330 | |
| }, | |
| { | |
| "url":"^http://ryogrid\\.net/idea/top", | |
| "pageElement":"//div[@class=\"main\"]/div[@class=\"idea_twit\"]", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":63455 | |
| }, | |
| { | |
| "url":"^https?://www\\.fromagee\\.jp/", | |
| "pageElement":"id(\"sort-area\")", | |
| "nextLink":"//li[@class=\"next\"]/a", | |
| "wedata.net.id":74655 | |
| }, | |
| { | |
| "url":"^http://registry\\.gimp\\.org/", | |
| "pageElement":"//div[starts-with(@id,'node-'][not(.//div/@id='comments')] | id('comments')/div[not(@class='item-list')] | //ol[contains(@class,'search-results')]/li", | |
| "nextLink":"//a[@title='Go to next page']", | |
| "wedata.net.id":63325 | |
| }, | |
| { | |
| "url":"^http://www\\.functionx\\.com/", | |
| "pageElement":"//body/div[3]", | |
| "nextLink":"//a[.='Next']", | |
| "wedata.net.id":77081 | |
| }, | |
| { | |
| "url":"^http://docs\\.komagata\\.org/", | |
| "pageElement":"//div[contains(concat(\" \",normalize-space(@class),\" \"), \" article \")]", | |
| "nextLink":"//a[contains(text(),\"Next\")]", | |
| "wedata.net.id":74641 | |
| }, | |
| { | |
| "url":"^http://www\\.goldenddl\\.org/", | |
| "pageElement":"//div[@class='base']", | |
| "nextLink":"//span[@class='nnext']/a", | |
| "wedata.net.id":77080 | |
| }, | |
| { | |
| "url":"^http://[^.]+\\.farnell\\.com/", | |
| "pageElement":"id('sProdList')/tbody/tr", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":32580 | |
| }, | |
| { | |
| "url":"^http://www\\.ohtabooks\\.com/", | |
| "pageElement":"//ol[@class='SrchList']/li | //div[@class='entryBox'] | id('backnumberList')//li", | |
| "nextLink":"//a[@class='link_next'] | //p[@class='blogNavi']/a[starts-with(.,'←')]", | |
| "wedata.net.id":63323 | |
| }, | |
| { | |
| "url":"^http://www\\.boredlion\\.com/", | |
| "pageElement":"//section[@class='entry-content clearfix']/*[not(@class='desktopsptopad1')]|id('main')/article[not(//section/@class='entry-content clearfix')]", | |
| "nextLink":"//a[span/@class='dnextpage-link' and not(//b='Source: ') or i/@class='fa fa-long-arrow-right']", | |
| "wedata.net.id":77523 | |
| }, | |
| { | |
| "url":"^http://dinosaurdracula\\.com/", | |
| "pageElement":"id('article')/section[div]", | |
| "nextLink":"//link[@rel='next']", | |
| "wedata.net.id":77356 | |
| }, | |
| { | |
| "url":"^https?://(www\\.)?ganool\\.ph", | |
| "pageElement":"//div[@class='row movies-list ']/*", | |
| "nextLink":"//li[@class='active']/following-sibling::li[1]/a", | |
| "wedata.net.id":77530 | |
| }, | |
| { | |
| "url":"^http://www\\.abominable\\.cc/", | |
| "pageElement":"//div[@class='photo']", | |
| "nextLink":"//span[@class='next_post']/a", | |
| "wedata.net.id":2369 | |
| }, | |
| { | |
| "url":"^http://gl\\.ali213\\.net/html", | |
| "pageElement":"//div[@class='glzjshow_con']/p[@style][1]/preceding-sibling::p[text()]", | |
| "nextLink":"id('after_this_page')", | |
| "wedata.net.id":74566 | |
| }, | |
| { | |
| "url":"^http://edayuuri\\.jugem\\.jp/", | |
| "pageElement":"//div[@class=\"entry\"]", | |
| "nextLink":"id(\"pageNav\")/a[text()=\">>\"] | id(\"page\")/a[starts-with(text(), \"<< \")]", | |
| "wedata.net.id":63644 | |
| }, | |
| { | |
| "url":"^http://mixi\\.jp/new_bbs\\.pl", | |
| "pageElement":"id(\"bodyArea\")//div[contains(concat(\" \", @class, \" \"), \" pageNavigation01 \")]/following-sibling::*[not(contains(translate(@class, \"NOPRS\", \"noprs\"), \"sponsor\")) and ./following-sibling::div[contains(concat(\" \", @class, \" \"), \" pageNavigation01 \")]]", | |
| "nextLink":"id(\"bodyArea\")//div[@class=\"pageList01\"]//li[@class=\"on\"]/following-sibling::li[1]/a|id(\"bodyArea\")//div[@class=\"pageList02\"]//a[starts-with(text(),\"次\")]", | |
| "wedata.net.id":46134 | |
| }, | |
| { | |
| "url":"https://(.+)\\.douban\\.com/.+", | |
| "pageElement":"//p[@class=\"ulfirst\"]/following-sibling::*[following-sibling::div[@class=\"paginator\"]]", | |
| "nextLink":"//span[@class='next']/a", | |
| "wedata.net.id":74461 | |
| }, | |
| { | |
| "url":"^http://lingyu\\.ikxs\\.org/.+", | |
| "pageElement":"id(\"BookText\")/p|//h1", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":77702 | |
| }, | |
| { | |
| "url":"^http://www\\.slashfilm\\.com/", | |
| "pageElement":"//div[@class=\"post\"][//link[@rel=\"canonical\"][@href=\"http://www.slashfilm.com\" or contains(@href,\"page\")]]|//div[@class=\"post\"]/h2[last()]/preceding-sibling::*[not(@id=\"title\")][not(//link[@rel=\"canonical\"][@href=\"http://www.slashfilm.com\" or contains(@href,\"page\")])]", | |
| "nextLink":"//link[@rel=\"next\"]", | |
| "wedata.net.id":34139 | |
| }, | |
| { | |
| "url":"^https?://([^/]\\.)?icook\\.tw", | |
| "pageElement":"//div[normalize-space(@class)='media list-card']|//div[@class='row main-content']/*", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":62966 | |
| }, | |
| { | |
| "url":"^http://androwire.jp/articles/", | |
| "pageElement":"//div[@class='content-box']/*[not(self::ul or @class='nextpageNavigation')]", | |
| "nextLink":"//li[@class='nextBtn']/a", | |
| "wedata.net.id":62719 | |
| }, | |
| { | |
| "url":"^http://nanos\\.jp/kaminomizu/", | |
| "pageElement":"//div[@class=\"waku\"]/div", | |
| "nextLink":"//a[@accesskey=\"#\"]", | |
| "wedata.net.id":75408 | |
| }, | |
| { | |
| "url":"^http://[^.]+\\.dtiblog\\.com/", | |
| "pageElement":"//div[@class='entry_box']", | |
| "nextLink":"//a[@title='次頁へ移動する']", | |
| "wedata.net.id":41255 | |
| }, | |
| { | |
| "url":"^http://www\\.honyaclub\\.com/", | |
| "pageElement":"//div[@class='result-item-inner']", | |
| "nextLink":"//ul[@class='result-pagenation']/li/a[contains(.,'次へ>')]", | |
| "wedata.net.id":63935 | |
| }, | |
| { | |
| "url":"^http://www\\.rsvp\\.com\\.au/", | |
| "pageElement":"id('rsvpcontent')/ol/li", | |
| "nextLink":"//a[.='Next']", | |
| "wedata.net.id":2506 | |
| }, | |
| { | |
| "url":"http://[^/]+\\.mydealz\\.de/*/", | |
| "pageElement":"//ul[@class=\"comments-list\"]", | |
| "nextLink":"//li[.//@class='pagi-link pagi-link--", | |
| "wedata.net.id":80952 | |
| }, | |
| { | |
| "url":"^http://twittbot\\.net/modules", | |
| "pageElement":"id('content')/*[@class='item' or self::br]", | |
| "nextLink":"id('content')/div/b/following-sibling::a[1]", | |
| "wedata.net.id":47038 | |
| }, | |
| { | |
| "url":"^http://mixi\\.jp/new_bbs\\.pl", | |
| "pageElement":"//ul[contains(concat(\" \",normalize-space(@class),\" \"), \" entryList01 \")]", | |
| "nextLink":"//div[contains(concat(\" \",normalize-space(@class),\" \"), \" pageList02 \")]//li[2]/a", | |
| "wedata.net.id":41226 | |
| }, | |
| { | |
| "url":"^http://favlook\\.osa-p\\.net/", | |
| "pageElement":"id('postlist')/li[not(@id='loginbtn')]", | |
| "nextLink":"id('next')", | |
| "wedata.net.id":29463 | |
| }, | |
| { | |
| "url":"^http://[^.]+\\.fotolia\\.com/", | |
| "pageElement":"//div[starts-with(@id,'content-thumb')]", | |
| "nextLink":"//div[@class='link-next-page clearfix center-content']/a", | |
| "wedata.net.id":32696 | |
| }, | |
| { | |
| "url":"^http://www\\.juangotoh\\.net/", | |
| "insertBefore":"id(\"pagenavi\")", | |
| "pageElement":"id(\"main\")/div", | |
| "nextLink":"id(\"pagenavi\")/span[@class=\"older\"]/a", | |
| "wedata.net.id":30115 | |
| }, | |
| { | |
| "url":"^http://www\\.goldderby\\.com/", | |
| "pageElement":"id('blog_body')/*[preceding-sibling::h1][following-sibling::div/@class='pagination']", | |
| "nextLink":"//li[@class=\"next\"]/a", | |
| "wedata.net.id":76473 | |
| }, | |
| { | |
| "url":"^http://www\\.kindgirls\\.com/", | |
| "pageElement":".//div[@class=\"gallery_list\"] | id(\"photo\")", | |
| "nextLink":".//*[@class=\"paginar\"]/a[contains(text(),\"Previous\")] | id(\"photo\")//a[contains(text(),\"Next\")][1]", | |
| "wedata.net.id":34527 | |
| }, | |
| { | |
| "url":"^http://www\\.exploader\\.net/", | |
| "pageElement":"id(\"newfiles\")/div[@class=\"list\"]", | |
| "nextLink":"//nav[@class=\"top\"]//li[@class=\"selected\"]/following-sibling::li[1]/a", | |
| "wedata.net.id":47944 | |
| }, | |
| { | |
| "url":"^http://db\\.museum\\.or\\.jp/", | |
| "pageElement":"//div[@align=\"LEFT\"]/*[self::a or self::br]", | |
| "nextLink":"//a[@accesskey=\"#\"]", | |
| "wedata.net.id":48316 | |
| }, | |
| { | |
| "url":"^http://www\\.moae\\.jp/comic/", | |
| "pageElement":"id('subt-block main-block')[id('page01')]|//ul[@class='box-set']", | |
| "nextLink":"//a[(.|..)/@class='next']", | |
| "wedata.net.id":74146 | |
| }, | |
| { | |
| "url":"^http://download\\.cnet\\.com/", | |
| "pageElement":"id('listing-product-list')/li[@class='listing-unit']|id('search-results')/a", | |
| "nextLink":"//li[@class='next']/a|//a[@class='control next']", | |
| "wedata.net.id":32491 | |
| }, | |
| { | |
| "url":"^http://www\\.shumilou\\.co/.+", | |
| "pageElement":"id(\"content\")/p[./b]/preceding-sibling::*[not(self::center or self::div[@style])]", | |
| "nextLink":"//div[@class='title']/a[4]", | |
| "wedata.net.id":77696 | |
| }, | |
| { | |
| "url":"^http://housefoods\\.jp/search", | |
| "pageElement":"//dl[@class='numList']/*", | |
| "nextLink":"//a[img/@class='next']", | |
| "wedata.net.id":49224 | |
| }, | |
| { | |
| "url":"^http://www\\.matomater\\.com/", | |
| "pageElement":"//ul[@class='media-list']/li", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":74054 | |
| }, | |
| { | |
| "url":"^http://www\\.xiachufang\\.com", | |
| "pageElement":"//div[@class='normal-recipe-list' or @class='menu-list' or @class='pure-u-3-4 search-result-list']/ul/li", | |
| "nextLink":"//a[.='下一页']", | |
| "wedata.net.id":73954 | |
| }, | |
| { | |
| "url":"^http://www\\.tomsguide\\.com/", | |
| "pageElement":"//div[@class='content']/*|//ul[@class='listing-items']/li", | |
| "nextLink":"//a[span/@class='label fa fa-long-arrow-right pull-right']|//li[@class='fa fa-caret-right label-btn']/a", | |
| "wedata.net.id":30151 | |
| }, | |
| { | |
| "url":"^https?://www\\.expansys\\.jp/", | |
| "pageElement":"//div[@class='productGrid']/*", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":49749 | |
| }, | |
| { | |
| "url":"^https?://\\w+\\.bongacams.com", | |
| "pageElement":"//*[@id=\"mls_models\"]/div", | |
| "nextLink":"//span[@class=\"mls_pager_next_page\"]/a[@class=\"next\"]", | |
| "wedata.net.id":80946 | |
| }, | |
| { | |
| "url":"^http://.+businessweekly\\.com", | |
| "pageElement":"//div[@class='MgMain' or @class='MaBox Mglt' or @class='content' and ../@class='article-content']|id('articleBlock')", | |
| "nextLink":"//a[@class='btNext' or ../@class='nextpage' or @title='下一頁']rn", | |
| "wedata.net.id":2130 | |
| }, | |
| { | |
| "url":"^http://www\\.denofgeek\\.com/", | |
| "pageElement":"//div[@class='item-list'][ul/@class='pager']/preceding-sibling::div[1]//*[starts-with(@class,'views-row views-row') or self::li]|//div[@class='field field-name-body']/*", | |
| "nextLink":"//li[@class='pager-next last']/a|//link[@rel='next']", | |
| "wedata.net.id":77299 | |
| }, | |
| { | |
| "url":"^http://www\\.webchikuma\\.jp/", | |
| "pageElement":"//div[@class='latest-archive-items']/*", | |
| "nextLink":"//li[contains(@class,'pagenation-next')]/a", | |
| "wedata.net.id":64116 | |
| }, | |
| { | |
| "url":"^http://web\\.meet-i\\.com/\\?", | |
| "pageElement":"id('contents')/dl", | |
| "nextLink":"//p[@class='link-next']/a", | |
| "wedata.net.id":25732 | |
| }, | |
| { | |
| "url":"^http://www\\.wisdomsoft\\.jp/", | |
| "pageElement":"//article/div[@class='Sections']", | |
| "nextLink":"//link[@rel=\"next\"]", | |
| "wedata.net.id":64143 | |
| }, | |
| { | |
| "url":"^http://[^./]+\\.pixnet\\.net/", | |
| "pageElement":"//*[@class='item-frame item-photo-frame' or @class='album-grid-list']", | |
| "nextLink":"//li[@class='picnav-li active']/following-sibling::li[1]/a|//a[@class='nextBtn']", | |
| "wedata.net.id":525 | |
| }, | |
| { | |
| "url":"^http://www\\.nudevista\\.com/", | |
| "pageElement":"id(\"listing listing_advert\")/table", | |
| "nextLink":"//div[contains(concat(\" \", @class, \" \"), \" pages \")]/a[.=\"Next \u00bb\"]", | |
| "wedata.net.id":50492 | |
| }, | |
| { | |
| "url":"^http://www\\.panoramio\\.com/", | |
| "pageElement":"id(\"photos_cont\")", | |
| "nextLink":"//div[@class=\"pages\"]/a[text()=\"Next \u00bb\"]", | |
| "wedata.net.id":34663 | |
| }, | |
| { | |
| "url":"^http://www\\.madthumbs\\.com/", | |
| "pageElement":"//li[@class=\"thumbbox\"] | //ul[@class=\"vids\"]/li | id(\"main\")/descendant::*[self::div or self::ul][contains(concat(\" \", @class, \" \"), \" vids \")][following-sibling::p[contains(concat(\" \", @class, \" \"), \" pagination \")]]", | |
| "nextLink":"//p[@class=\"pagination\"]/a[last()] | //p[contains(concat(\" \", @class, \" \"), \" pagination \")]/a[contains(., \"next\")]", | |
| "wedata.net.id":50497 | |
| }, | |
| { | |
| "url":"^http://diamond\\.jp/articles/", | |
| "pageElement":"id(\"main-contents\")/*[not(@class=\"related-info\" or (./strong and count(.//a)>1))]|id(\"title profdetail\")", | |
| "nextLink":"//p[./strong][count(.//a)>1]/a[last()][number(substring-after(./@href,\"-/\"))>number(substring-after(//meta[@property=\"og:url\"]/@content,\"-/\"))]", | |
| "wedata.net.id":77367 | |
| }, | |
| { | |
| "url":"^http://macholic\\.jugem\\.jp/", | |
| "pageElement":"id(\"main\")/div[@class=\"entry\"][./div[@class=\"inner\"]/div[@class=\"entry_title\"]]", | |
| "nextLink":"id(\"main\")/*[last()][self::div and @class=\"entry\"]/div[@class=\"entry_navi\"]/a[contains(.,\">>\")]", | |
| "wedata.net.id":30246 | |
| }, | |
| { | |
| "url":"^http://[^./]+\\.exteen\\.com/", | |
| "pageElement":"//div[@class='entry']", | |
| "nextLink":"//div[@class='nav']/a[contains(.,'Previous')]", | |
| "wedata.net.id":34769 | |
| }, | |
| { | |
| "url":"^http://www\\.csmonitor\\.com/", | |
| "pageElement":"id('content-listing')//li", | |
| "nextLink":"id('next-button')", | |
| "wedata.net.id":34846 | |
| }, | |
| { | |
| "url":"http://www\\.ntticc\\.or\\.jp/", | |
| "pageElement":"id('top_navi')/following-sibling::*", | |
| "nextLink":"id('top_navi_right')/a[contains(.,'< ')]", | |
| "wedata.net.id":30285 | |
| }, | |
| { | |
| "url":"^http://twitpic\\.com/photos/.", | |
| "pageElement":"id(\"photo-container\")/*", | |
| "nextLink":"id(\"user-pagination\")/p[contains(concat(\" \", @class, \" \"), \" pagination \")]/a[contains(concat(\" \", @class, \" \"), \" active \")]/following-sibling::a[1]", | |
| "wedata.net.id":29392 | |
| }, | |
| { | |
| "url":"^http://www\\.gamer\\.ne\\.jp/", | |
| "pageElement":"(//div[@class='newsListFull']|id('gameList newsImageFull'))/ul/li", | |
| "nextLink":"//a[(.|..)/@class='next']", | |
| "wedata.net.id":74688 | |
| }, | |
| { | |
| "url":"^http://www\\.apk-mania\\.com/", | |
| "pageElement":"//div[@class=\"post bar hentry\"]", | |
| "nextLink":"id(\"Blog1_blog-pager-older-link\")", | |
| "wedata.net.id":77168 | |
| }, | |
| { | |
| "url":"^http://www\\.veoh\\.com/find/", | |
| "pageElement":"id('browseList')/li", | |
| "nextLink":"//ul[@class='pagination ']/li[not(a or @class='pagingGap')]/following-sibling::li/a", | |
| "wedata.net.id":64670 | |
| }, | |
| { | |
| "url":"^http://(?:[^.]+\\.)?asg\\.to/", | |
| "pageElement":"id(\"list\")", | |
| "nextLink":"id(\"list\")/p/node()[not(self::a) and (number(translate(self::text(),\"|\",\" \"))>0)]/following-sibling::a[1]", | |
| "wedata.net.id":27071 | |
| }, | |
| { | |
| "url":"^http://www\\.blendswap\\.com/", | |
| "pageElement":"//div[contains(@class,'index cage-') or contains(@class,'contained-body')]/*", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":61691 | |
| }, | |
| { | |
| "url":"^https://codeiq\\.jp/magazine/", | |
| "pageElement":"//div[@class=\"article\"]", | |
| "nextLink":"//link[@rel=\"next\"]", | |
| "wedata.net.id":77285 | |
| }, | |
| { | |
| "url":"^http://tieba\\.baidu\\.com/.+", | |
| "pageElement":"id('thread_list')/li", | |
| "nextLink":"//a[@class='next pagination-item ']", | |
| "wedata.net.id":73803 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?wtop\\.com/", | |
| "pageElement":"//ul[@class='EntriesList content ']/li", | |
| "nextLink":"//a[@class='next page-numbers']", | |
| "wedata.net.id":2584 | |
| }, | |
| { | |
| "url":"^http://www\\.gamasutra\\.com/", | |
| "pageElement":"//div[@class='item_body mobile_image_transform']/*|//div[@class='feed_item' or @class='blogentry']|//div[@class='content_box_middle']/hr", | |
| "nextLink":"//a[img/@alt='Next']|//div[@class='pagination right']/span/following-sibling::a[1]|//a[contains(.,'[Next]')]", | |
| "wedata.net.id":33452 | |
| }, | |
| { | |
| "url":"^https?://gist\\.github\\.com/", | |
| "pageElement":"//div[@class='gist-snippet']", | |
| "nextLink":"//a[.='Older']", | |
| "wedata.net.id":2030 | |
| }, | |
| { | |
| "url":"^http://www\\.homedepot\\.com/", | |
| "pageElement":"id('products')", | |
| "nextLink":"//a[@title='Next']", | |
| "wedata.net.id":76499 | |
| }, | |
| { | |
| "url":"^http://www\\.brusheezy\\.com/", | |
| "pageElement":"//ul[@class='grid items']/li", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":609 | |
| }, | |
| { | |
| "url":"^http://www\\.tvfanatic\\.com/", | |
| "pageElement":"id('infinite')/*|//div[@class='item'][not(id('infinite'))]", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":76250 | |
| }, | |
| { | |
| "url":"^http://www\\.wishscope\\.com/", | |
| "pageElement":"//div[@class=\"main\"]", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":61026 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?nomu\\.com/", | |
| "pageElement":"//li[@class=\"click_Row\"]", | |
| "nextLink":"//li[@class=\"next mr0\"]/a", | |
| "wedata.net.id":30540 | |
| }, | |
| { | |
| "url":"^http://blog\\.pokkeboy\\.com/", | |
| "pageElement":"id('content')/*[@class='cSpace' or @class='post']", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":53758 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?cam4\\.com/", | |
| "pageElement":"id(\"directoryDiv\")/*", | |
| "nextLink":"//div[@class=\"pager\"]/span/following-sibling::a[1]", | |
| "wedata.net.id":32756 | |
| }, | |
| { | |
| "url":"^http://www\\.bikesearch\\.jp/", | |
| "pageElement":"//div[@class=\"row\"][./following-sibling::hr]|//div[@class=\"row\"]/following-sibling::hr", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":72732 | |
| }, | |
| { | |
| "url":"^http://blog\\.sharplab\\.net/", | |
| "pageElement":"id('contentFooter')/preceding-sibling::div[@class='block']", | |
| "nextLink":"id('contentFooter')//div[@class='nextLink']/a|//link[@rel='prev']", | |
| "wedata.net.id":29278 | |
| }, | |
| { | |
| "url":"^http://satoshi\\.blogs\\.com/", | |
| "pageElement":"id(\"beta-inner\")/div[contains(concat(\" \", @class, \" \"), \" entry \")]", | |
| "nextLink":"//span[@class=\"pager-right\"]/a", | |
| "wedata.net.id":32365 | |
| }, | |
| { | |
| "url":"^https?://www\\.uta-net\\.com/", | |
| "pageElement":"(//div[starts-with(@class,'interview_contents')]|id('livereport_list'))//li[not(div/@class='pg')]|//table[@class='style1']|//div[@class='main_body']//tr[th]|//div[@id='ichiran_main']|(//table[@id='ranking_table']|//div[@class='left_area'])//tr[td]", | |
| "nextLink":"//a[span='>' or @class='next_newsongs' or span/@class='next']", | |
| "wedata.net.id":64713 | |
| }, | |
| { | |
| "url":"^http://www\\.last\\.fm/forum/", | |
| "pageElement":"//table[@class='forumtable']//tr[td]|//ul[@class=\"forumComments\"]/li", | |
| "nextLink":"//a[@class='nextlink']", | |
| "wedata.net.id":72700 | |
| }, | |
| { | |
| "url":"^http://www\\.nippon\\.com/ja/", | |
| "pageElement":"//div[@class=\"tab01 section_wrp active\"]/div", | |
| "nextLink":"//dt[@class=\"next_page\"]/a", | |
| "wedata.net.id":80850 | |
| }, | |
| { | |
| "url":"^http://.+\\.fujitv\\.co\\.jp/", | |
| "pageElement":"//div[@class='listsearch']/dl|//div[@class='clearfix']", | |
| "nextLink":"//li[@class='focus']/following-sibling::li[1]/a|//a[@class='pager-next-btn']", | |
| "wedata.net.id":77859 | |
| }, | |
| { | |
| "url":"^http://diamond\\.jp/category/", | |
| "pageElement":"id(\"mp-ie\")/following-sibling::ul/* | id(\"mp-ie\")/preceding-sibling::ul/*", | |
| "nextLink":"id(\"mp-ie\")//*[contains(concat(\" \", @class, \" \"), \" next-p \") or contains(concat(\" \", @class, \" \"), \" next_p \")]/a", | |
| "wedata.net.id":29269 | |
| }, | |
| { | |
| "url":"^http://bitsnoop\\.com/search/", | |
| "pageElement":"id('torrents')/li", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":54279 | |
| }, | |
| { | |
| "url":"^http://www\\.wordsmyth\\.net/", | |
| "pageElement":"//div[@class='wordlist']//tr[position()!='1']", | |
| "nextLink":"//div[@class='arrow']/a", | |
| "wedata.net.id":77187 | |
| }, | |
| { | |
| "url":"^http://forum\\.hardware\\.fr/", | |
| "pageElement":"id('mesdiscussions')//*[starts-with(@class,'messagetable') or starts-with(@class,'sujet ligne')]", | |
| "nextLink":"//div[@class='pagepresuiv']//a[not(@href='#bas' or @href='#haut')]", | |
| "wedata.net.id":54283 | |
| }, | |
| { | |
| "url":"^http://www\\.codemicro\\.com/", | |
| "pageElement":"//table[@class='content_text']//table//tr[td/a]", | |
| "nextLink":"//strong[@class=\"blue_txt\"]/text()[string-length(normalize-space()) > 1]/following-sibling::a[1]", | |
| "wedata.net.id":76980 | |
| }, | |
| { | |
| "url":"^http://kokoro\\.squares\\.net", | |
| "pageElement":"//div[starts-with(@id,\"post-\")]/p[@class=\"meta\"][not(./preceding-sibling::hr)]/preceding-sibling::*|//div[starts-with(@id,\"post-\")]/hr[last()]/preceding-sibling::*", | |
| "nextLink":"//link[@rel=\"prev\"]", | |
| "wedata.net.id":74819 | |
| }, | |
| { | |
| "url":"^http://forgifs\\.com/gallery/", | |
| "pageElement":"id(\"gsThumbMatrix\")/tbody/tr", | |
| "nextLink":"//a[@class=\"next\"]", | |
| "wedata.net.id":692 | |
| }, | |
| { | |
| "url":"^http://www\\.appsafari\\.com/", | |
| "pageElement":"id(\"applist\")/div[contains(concat(\" \", @class, \" \"), \" app \")]", | |
| "nextLink":"id(\"applist\")/div[@class=\"navigation\"]//a[@class=\"pagenext\"]", | |
| "wedata.net.id":2010 | |
| }, | |
| { | |
| "url":"^http://.+\\.cheezburger\\.com", | |
| "pageElement":"//div[@class='content-card ']", | |
| "nextLink":"//a[@class='glyphicon glyphicon-chevron-right']", | |
| "wedata.net.id":29231 | |
| }, | |
| { | |
| "url":"^http://www\\.doyouhike\\.net/", | |
| "pageElement":"//table[@class='list']//tr[td]|//div[@class='postbit']", | |
| "nextLink":"//a[.='Next »']", | |
| "wedata.net.id":33237 | |
| }, | |
| { | |
| "url":"^http://bitsnoop\\.com/browse/", | |
| "pageElement":"id(\"text\")/table//tr[count(ancestor::table)=1][position()>1]", | |
| "nextLink":"id(\"content\")//div[contains(concat(\" \", @class, \" \"), \" notice \")]/b/following-sibling::a[1]", | |
| "wedata.net.id":54434 | |
| }, | |
| { | |
| "url":"^http://www\\.slashgear\\.com/", | |
| "pageElement":"//div[@class='posts home-posts latest-grid']/article", | |
| "nextLink":"//a[.='Next']", | |
| "wedata.net.id":74970 | |
| }, | |
| { | |
| "url":"^http://www\\.mishimaga\\.com/", | |
| "pageElement":"//ul[@class=\"like_bt cf\"]/preceding-sibling::*[not(@class=\"lead\" or self::h2 or (self::p[./a/img] and self::p[count(./a)>1]))]|//div[@class=\"lead\"][//li[@class=\"link_page\"]/a[not(contains(@href,\"special\"))]]", | |
| "nextLink":"id(\"backnumber\")/ul/li/a[contains(text(),concat(\"第\",number(substring-before(substring-after(//div[@class=\"main\"]/h3/text(),\"第\"),\"回\"))+1,\"回\"))]|id(\"backnumber\")//li[./span[contains(text(),substring-before(//div[@class=\"main\"]/p[@class=\"date\"]/text(),\"更新\"))]]/following-sibling::li[1]/a", | |
| "wedata.net.id":59872 | |
| }, | |
| { | |
| "url":"^http://www\\.furanskin\\.net/", | |
| "pageElement":"id(\"content\")/div[contains(@class,\"datewhole\")]", | |
| "nextLink":"id(\"content\")/div//a[contains(text(),\"\u6b21\u30da\u30fc\u30b8\u3078\") or @rel=\"prev\"]", | |
| "wedata.net.id":39558 | |
| }, | |
| { | |
| "url":"^http://serif\\.hatelabo\\.jp/", | |
| "pageElement":"id('body')/div[@class='serif_data']", | |
| "nextLink":"//a[@class='pager-next'][1]", | |
| "wedata.net.id":707 | |
| }, | |
| { | |
| "url":"^http://www\\.sacurrent\\.com/", | |
| "pageElement":"//div[@class='archiveListing clearfix']", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":74847 | |
| }, | |
| { | |
| "url":"^http://anond\\.hatelabo\\.jp/", | |
| "pageElement":"id('body')/div[@class='day']", | |
| "nextLink":"//div[@class=\"pager-l\"][count(./a)>1 or //h1[./a]]/a[last()]|//div[@class=\"pager-l\"][not(count(./a)>1 or //h1[./a])]/a[@href=concat(\"/\",substring-after(//h2/a/@href,\"/\"),\"?page=2\")]", | |
| "wedata.net.id":713 | |
| }, | |
| { | |
| "url":"^http://r25\\.yahoo\\.co\\.jp/", | |
| "pageElement":"//p[@class=\"seq\"]/preceding-sibling::*|//div[@class=\"section\"][./div[@id=\"article\"]][not(//p[@class=\"seq\"])]", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":30831 | |
| }, | |
| { | |
| "url":"^http://www\\.onsen\\.ag/blog/", | |
| "pageElement":"id('contCenterInner')/article", | |
| "nextLink":"//li[@class='nextPage']/a | //link[@rel='prev']", | |
| "wedata.net.id":64830 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?jiji\\.com/", | |
| "pageElement":"id(\"photo-area\")", | |
| "nextLink":"//span[@class=\"bt_next\"]/a", | |
| "wedata.net.id":1945 | |
| }, | |
| { | |
| "url":"^http://figure\\.seesaa\\.net/", | |
| "pageElement":"id(\"content\")/div[@class=\"blog\"]", | |
| "nextLink":"id(\"content\")/div[@class=\"wp-pagenavi\"]//span[@class=\"current\"]/following-sibling::a[1]", | |
| "wedata.net.id":30847 | |
| }, | |
| { | |
| "url":"^http://blog\\.chabudai\\.com/", | |
| "pageElement":"id(\"main\")/div[contains(@class,\"entry\")]", | |
| "nextLink":"id(\"main\")/*[contains(@class,\"navi\")]//a[parent::li[@class=\"next\"] or parent::div[@class=\"entry_navi\"]]", | |
| "wedata.net.id":39489 | |
| }, | |
| { | |
| "url":"^http://subs\\.com\\.ru/.+?\\?", | |
| "pageElement":"//table[@class='cells']//tr[position()>1] | //tr[@class='odd' or @class='even']", | |
| "nextLink":"//span[contains(@class,'pagenav_next')]//a", | |
| "wedata.net.id":77254 | |
| }, | |
| { | |
| "url":"^http://www\\.sports-ws\\.com/", | |
| "pageElement":"id('resultList')/li", | |
| "nextLink":"//li[@class='nextBtn']/a", | |
| "wedata.net.id":32033 | |
| }, | |
| { | |
| "url":"^https?://www\\.discogs\\.com/", | |
| "pageElement":"id('artist search_results')/*", | |
| "nextLink":"//a[@class='pagination_next']", | |
| "wedata.net.id":64850 | |
| }, | |
| { | |
| "url":"^http://www\\.vistaprint\\.jp/", | |
| "pageElement":"id('lstPreviewArea')/li", | |
| "nextLink":"id('aPageNext')", | |
| "wedata.net.id":64916 | |
| }, | |
| { | |
| "url":"^http://[^./]+\\.ifeng\\.com/.", | |
| "pageElement":"id('artical_real')/*|id('list01')/li|//div[starts-with(@class,'wqyl box')]", | |
| "nextLink":"//div[contains(@class, 'pager')]/a[last()]|id('pagenext')|//a[@class='a_ts02']", | |
| "wedata.net.id":54692 | |
| }, | |
| { | |
| "url":"^http://travel\\.hikaku\\.com/", | |
| "pageElement":"//div[@class=\"box_default\"]", | |
| "nextLink":"//span[@class=\"current_page\"]/following-sibling::a[1]", | |
| "wedata.net.id":79985 | |
| }, | |
| { | |
| "url":"^http://steps\\.dodgson\\.org/", | |
| "pageElement":"//article", | |
| "nextLink":"//a[@class=\"prev\"]", | |
| "wedata.net.id":74862 | |
| }, | |
| { | |
| "url":"^http://www\\.carscoops\\.com/", | |
| "pageElement":"//div[@itemprop=\"blogPost\"][not(.//div[@class=\"post-footer\"])]|//div[@class=\"post-footer\"]/preceding-sibling::node()", | |
| "nextLink":"id(\"Blog1_blog-pager-older-link\")", | |
| "wedata.net.id":76949 | |
| }, | |
| { | |
| "url":"^http://blackamericaweb\\.com/", | |
| "pageElement":"//div[@class='posts-list with-featured-story']/*", | |
| "nextLink":"//a[@class='next page-numbers']", | |
| "wedata.net.id":76925 | |
| }, | |
| { | |
| "url":"^http://www\\.tweaktown\\.com/", | |
| "pageElement":"id('KonaBody')/*[not(@class='page_all_content')]", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":67193 | |
| }, | |
| { | |
| "url":"^http://www\\.lolibrary\\.org/", | |
| "pageElement":"id('content-area')/div[starts-with(@class,'node')]|//div[@class='view-content']/*", | |
| "nextLink":"//li[@class='pager-next']/a", | |
| "wedata.net.id":67192 | |
| }, | |
| { | |
| "url":"^http://(:?www\\.)?meeda\\.jp/", | |
| "pageElement":"//div[@class=\"block_line_solid_b\"]", | |
| "nextLink":"//a[@class=\"page_next\"]", | |
| "wedata.net.id":31989 | |
| }, | |
| { | |
| "url":"^http://p\\.twipple\\.jp/user/", | |
| "pageElement":"id(\"simple_list\")", | |
| "nextLink":"id(\"mypage\")//p[@class=\"more\"]/a[.=\"next\"]", | |
| "wedata.net.id":55175 | |
| }, | |
| { | |
| "url":"^https?://code\\.google\\.com/", | |
| "pageElement":"//tr[@class='ng-scope']", | |
| "nextLink":"//a[@class='ng-scope']", | |
| "wedata.net.id":929 | |
| }, | |
| { | |
| "url":"^https?://ipon\\.hu/elemzesek/", | |
| "pageElement":"//div[@class=\"pager\"][last()]/preceding-sibling::br[1]/preceding-sibling::node()[not(@class=\"pager\" or self::header)]", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":56772 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?nigma\\.ru/", | |
| "pageElement":"id(\"results\")/ol", | |
| "nextLink":"id(\"pageNext\")", | |
| "wedata.net.id":55200 | |
| }, | |
| { | |
| "url":"^http://mattn\\.kaoriya\\.net/", | |
| "pageElement":"//div[@class='blog hfeed']/*", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":65295 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?tagoo\\.ru/", | |
| "pageElement":".//div[@class=\"result_block\"]//index", | |
| "nextLink":".//div[@class=\"pages\"]/a[@class=\"next\"]", | |
| "wedata.net.id":29066 | |
| }, | |
| { | |
| "url":"^http://lapilazu\\.jugem\\.jp/", | |
| "pageElement":"id(\"wrapper\")//div[@class=\"entry\"]", | |
| "nextLink":"id(\"wrapper\")//li[contains(@class,\"next\")]/a[contains(text(),\">>\")]", | |
| "wedata.net.id":31885 | |
| }, | |
| { | |
| "url":"^http://www\\.javaworld\\.com/", | |
| "pageElement":"//div[@class='river-well article']", | |
| "nextLink":"id('load-more-index')", | |
| "wedata.net.id":28213 | |
| }, | |
| { | |
| "url":"https://getsatisfaction\\.com/", | |
| "pageElement":"//ul[@class='topic_list' or @class='result_list']/li", | |
| "nextLink":"//span[@class='next_link translate']/a", | |
| "wedata.net.id":74949 | |
| }, | |
| { | |
| "url":"^http://www\\.yodobashi\\.com/", | |
| "pageElement":"id(\"spt_hznList\")", | |
| "nextLink":"//ul[(@class=\"hznList\")]/li/a[(@class=\"next clicklog cl-pgnLow\")]", | |
| "wedata.net.id":2841 | |
| }, | |
| { | |
| "url":"^http://www\\.nexus-web\\.net/", | |
| "pageElement":"id(\"contents2way_left\")/*[self::div[contains(concat(\" \",normalize-space(@class),\" \"), \" interview \")]]", | |
| "nextLink":"//li[a/@class='active']/following-sibling::li[1]/a", | |
| "wedata.net.id":74864 | |
| }, | |
| { | |
| "url":"^http://webheibon\\.jp/koyomi/", | |
| "pageElement":"id(\"contents_innr\")", | |
| "nextLink":"//div[@class=\"bn_box\"]//li[contains(text(),concat(\"第\",substring-before(substring-after(//div[@class=\"ttl\"]/p,\"第\"),\"回\"),\"回\"))]/following-sibling::li[1]/a", | |
| "wedata.net.id":77209 | |
| }, | |
| { | |
| "url":"^http://nikkan-spa\\.jp/\\d+/.", | |
| "pageElement":"//div[@class='entryContent']/*[preceding-sibling::div/@class='pager pagerAttachment'][following-sibling::div/@id='nav-below']", | |
| "nextLink":"//div[@class='nav-next']/a", | |
| "wedata.net.id":76738 | |
| }, | |
| { | |
| "url":"^https://www\\.quologia\\.com/", | |
| "pageElement":"//main[@class='quote-list']/div", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":77451 | |
| }, | |
| { | |
| "url":"^http://www\\.macrumors\\.com/", | |
| "pageElement":"//div[@class='wrapper']/div[starts-with(@class,'article')]", | |
| "nextLink":"//div[@class='right']/a", | |
| "wedata.net.id":77625 | |
| }, | |
| { | |
| "url":"^http://www\\.phicatube\\.net/", | |
| "pageElement":"//div[@class=\"col-sm-6 col-md-4 col-lg-4\"]", | |
| "nextLink":"//a[@class=\"prevnext\"]", | |
| "wedata.net.id":77474 | |
| }, | |
| { | |
| "url":"^http://[^.]+\\.curecos\\.com/", | |
| "pageElement":"id('member-wrapper mycure-simpleview guestbook-body comment-body DiaryView-article DiaryView-comment picturebody recent-photo')/* | id('album-view-simple album-view-list recent-photos recent-diary-list schedule-content')/table |(id('view-detail view-simple view-pictureList')|//table[@class='picturesBox'])//tr|id('picture-content')/parent::div|id('cosmember-wrapper simpleview recent-diary-entry-list')/div|id('view-detailList')/ul/li", | |
| "nextLink":"//a[../@class='next' or @class='next-navi']", | |
| "wedata.net.id":1794 | |
| }, | |
| { | |
| "url":"^http://www\\.slevykurzu\\.cz/", | |
| "pageElement":"//div[contains(concat(' ', @class, ' '), ' kurz-item ')]", | |
| "nextLink":"//div[contains(concat(' ', @class, ' '), ' paginator ')]//span[contains(concat(' ', @class, ' '), ' current ')]/following-sibling::a[1]", | |
| "wedata.net.id":66807 | |
| }, | |
| { | |
| "url":"^http://camlinks\\.craym\\.eu/", | |
| "pageElement":"//body/div[1]/div[2]/table", | |
| "nextLink":"//li/a[@aria-label='Next']", | |
| "wedata.net.id":80773 | |
| }, | |
| { | |
| "url":"^http://youkoseki\\.com/diary/", | |
| "pageElement":"//div[@class=\"diary\"]|id(\"disqus_thread\")/following-sibling::text()", | |
| "nextLink":"//div[@class=\"arrow_menu_l\"]/a", | |
| "wedata.net.id":31709 | |
| }, | |
| { | |
| "url":"^http://doujin-eromanga\\.com/", | |
| "pageElement":"//div[@id='main-contents']//div[@class='post']", | |
| "nextLink":"id('main-contents')//a[@class='next']", | |
| "wedata.net.id":80680 | |
| }, | |
| { | |
| "url":"^http://www\\.ebook3000\\.com/", | |
| "pageElement":"//div[contains(concat(' ', @class, ' '), ' index_box ') or contains(concat(' ', @class, ' '), ' list_box ')]", | |
| "nextLink":"//div[contains(concat(' ', @class, ' '), ' change_page ')]//a[.='Next']", | |
| "wedata.net.id":66804 | |
| }, | |
| { | |
| "url":"^http://smile-pro\\.net/photo/", | |
| "pageElement":"//div[@class='photo_lib']/ul/li", | |
| "nextLink":"//a[@title='next page']", | |
| "wedata.net.id":1328 | |
| }, | |
| { | |
| "url":"^http://www\\.itpro\\.co\\.uk/", | |
| "pageElement":"//ul[@class='view-rows']/li", | |
| "nextLink":"//li[@class='pager-next last']/a", | |
| "wedata.net.id":80682 | |
| }, | |
| { | |
| "url":"^http://fluffyandmervin\\.com/", | |
| "pageElement":"id('e')", | |
| "nextLink":"id('l')", | |
| "wedata.net.id":39037 | |
| }, | |
| { | |
| "url":"^http://www\\.znamylekar\\.cz/", | |
| "pageElement":"//ul[@class='search-list list-unstyled']/li", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":55948 | |
| }, | |
| { | |
| "url":"^http://www\\.themebeta\\.com/", | |
| "pageElement":"//div[@class='content']/div[@class='row'][1]/*", | |
| "nextLink":"//ul[@class='pagination']/li[@class='active']/following-sibling::li[1]/a", | |
| "wedata.net.id":66573 | |
| }, | |
| { | |
| "url":"^https?://www\\.openhub\\.net/", | |
| "pageElement":"id(\"page_contents\")/table/tbody/tr", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":1772 | |
| }, | |
| { | |
| "url":"^http://staff\\.dtiblog\\.com/", | |
| "pageElement":"id('main-adjust')/div", | |
| "nextLink":"//a[@title='次頁へ移動する']", | |
| "wedata.net.id":66432 | |
| }, | |
| { | |
| "url":"^http://hardwareinsights\\.com", | |
| "pageElement":"//p[strong='Pages:']/preceding-sibling::node()", | |
| "nextLink":"//p/strong[normalize-space(.)='Pages:']/following-sibling::text()[number()>0]/following-sibling::a[1]", | |
| "wedata.net.id":76803 | |
| }, | |
| { | |
| "url":"^http://blog\\.nicovideo\\.jp/", | |
| "pageElement":"//div[@class='entry' or starts-with(@id,'entry-') or @class='dataSection' or @class='article-body']|//div[@class='section']/dl[not(//div/@class='article-body')]|//h2[@class='article-header nolink'][not(id('pageList'))]", | |
| "nextLink":"id('navibar')/a[1]|//a[.='NEXT']|//link[@rel='prev'][contains(@href,'html')]", | |
| "wedata.net.id":1765 | |
| }, | |
| { | |
| "url":"^http://voffka\\.com/archives/", | |
| "pageElement":"//*[@class=\"blogbody\"]", | |
| "nextLink":"id(\"menu\")/a[1]", | |
| "wedata.net.id":77219 | |
| }, | |
| { | |
| "url":"^http://www\\.qihuiwang\\.com/", | |
| "pageElement":"//ul[@class='proList']/li", | |
| "nextLink":"//span[@class='this-page left']/following-sibling::span[1]/a", | |
| "wedata.net.id":77210 | |
| }, | |
| { | |
| "url":"^https://www\\.blwisdom\\.com/", | |
| "pageElement":"id('g_aTtlBox')/following-sibling::*[following-sibling::div/@class='g_pagenate01']|id('g_aSectionMainCont')/*", | |
| "nextLink":"id('pgnt1')/li/a[@class='g_nextBtn']|id('g_prevArticle')/a", | |
| "wedata.net.id":76871 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?cyzo\\.com/", | |
| "pageElement":"id(\"alpha-inner\")/div[@class=\"entry-asset\"]", | |
| "nextLink":"id(\"alpha-inner\")/div[@class=\"content-nav\"]/a[last()]", | |
| "wedata.net.id":1730 | |
| }, | |
| { | |
| "url":"^http://aquapple\\.jugem\\.jp/", | |
| "pageElement":"id('content')/div[@class='section']", | |
| "nextLink":"//div[@class=\"pagingLink\"][count(.//a)>1 or .//a[@href=\"http://aquapple.jugem.jp/?page=1\"]]//a[last()]", | |
| "wedata.net.id":2836 | |
| }, | |
| { | |
| "url":"^http://jintrick\\.net/agenda/", | |
| "pageElement":"//div[@class='topic-path']//following-sibling::*[following-sibling::div/@class='navi']", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":26712 | |
| }, | |
| { | |
| "url":"^http://www\\.techradar\\.com/", | |
| "pageElement":"id('article-body')/*", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":2761 | |
| }, | |
| { | |
| "url":"^http://lofi\\.e-hentai\\.org/", | |
| "pageElement":"id(\"ig gh sd\")", | |
| "nextLink":"id(\"ia\")/a[text()=\"Next Page >\"]", | |
| "wedata.net.id":38240 | |
| }, | |
| { | |
| "url":"^http://(forum\\.)?mobilism\\.", | |
| "pageElement":"id('page-body')//section|id('page-body')/main/table[last()]/tbody/tr|//div[@class='row-fluid blue-bar']", | |
| "nextLink":"//a[i/@class='icon-chevron-right']", | |
| "wedata.net.id":65541 | |
| }, | |
| { | |
| "url":"^http://www\\.anandtech\\.com/", | |
| "pageElement":"//section[@class='main_cont']/div[starts-with(@class,'cont_box')]", | |
| "nextLink":"//a[text()='▶']", | |
| "wedata.net.id":65621 | |
| }, | |
| { | |
| "url":"^https://cacoo\\.com/diagrams/", | |
| "insertBefore":"//div[@class=\"pagenation\"][2]", | |
| "pageElement":"//table[contains(@class, \"list\")]", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":38645 | |
| }, | |
| { | |
| "url":"^http://www\\.bit-tech\\.net/.", | |
| "pageElement":"//div[@class=\"articleCopy\"]", | |
| "nextLink":"//div[@class=\"pageNav\"]/div[@class=\"next\"]/a", | |
| "wedata.net.id":38694 | |
| }, | |
| { | |
| "url":"^http://www\\.iphonecake\\.com", | |
| "pageElement":"id('newapps')/div", | |
| "nextLink":"//li[@class='ui-pager-right']/a", | |
| "wedata.net.id":65583 | |
| }, | |
| { | |
| "url":"^http://www\\.sheknows\\.com/", | |
| "pageElement":"//article[@id]", | |
| "nextLink":"//link[@rel=\"next\"][//div[@class=\"ui-photo\"]/div]|//a[@class=\"home-link\"][not(//div[@class=\"ui-photo\"]/div)]", | |
| "wedata.net.id":80936 | |
| }, | |
| { | |
| "url":"^http://www\\.gdm\\.or\\.jp/.", | |
| "pageElement":"//tr[./td[@class=\"main_text\"][not(./a[@href=\"#\"])]]", | |
| "nextLink":"//span[@class='page'][not(a)]/following-sibling::span[1]/a", | |
| "wedata.net.id":38732 | |
| }, | |
| { | |
| "url":"^http://www\\.magnetdl\\.com/", | |
| "pageElement":"//tr[td/@class='n']", | |
| "nextLink":"//a[contains(.,'Next Page >')]", | |
| "wedata.net.id":65554 | |
| }, | |
| { | |
| "url":"^http://www\\.techworm\\.net/", | |
| "pageElement":"//div[@class='column half']", | |
| "nextLink":"//link[@rel='next']", | |
| "wedata.net.id":77629 | |
| }, | |
| { | |
| "url":"^http://www\\.immoral\\.jp/t/", | |
| "pageElement":"//div[contains(concat(\" \", @class, \" \"), \" contents \") or contains(concat(\" \", @class, \" \"), \" c_3 \")]", | |
| "nextLink":"//a[contains(text(), \"\u6b21\u3078\")]", | |
| "wedata.net.id":55842 | |
| }, | |
| { | |
| "url":"^http://www\\.xinhuaxia\\.jp/", | |
| "pageElement":"id(\"main_contents\")//div[@class=\"news_body\"]", | |
| "nextLink":"//div[@class=\"pagination\"]/span/following-sibling::a", | |
| "wedata.net.id":74913 | |
| }, | |
| { | |
| "url":"^https?://blog\\.qiita\\.com/", | |
| "pageElement":"//article", | |
| "nextLink":"//a[@class='pagination_prev']", | |
| "wedata.net.id":76870 | |
| }, | |
| { | |
| "url":"^http://seek\\.com\\.au/jobs/", | |
| "pageElement":"//div[@class='jobs-list jobs-list-primary']/article", | |
| "nextLink":"//a[span/@class='state-arrow-right mod-arrow']", | |
| "wedata.net.id":38256 | |
| }, | |
| { | |
| "url":"^http://tegaki\\.pipa\\.jp/.+", | |
| "pageElement":"//div[@class='TopContents']/*[self::span or @class='ThreadDetail']|//tr[@class='EventListBody']|//center/*[preceding-sibling::form][following-sibling::img[@style]/@width='100%']", | |
| "nextLink":"//a[starts-with(@class,'PageBarItem') and .='>' or .='Next>>']", | |
| "wedata.net.id":1528 | |
| }, | |
| { | |
| "url":"^http://www\\.c\\.urvy\\.org/", | |
| "pageElement":"id(\"theActualComic\")/a", | |
| "nextLink":"//div[@class=\"aNavbar\"]/p[2]/a[last()]", | |
| "wedata.net.id":77633 | |
| }, | |
| { | |
| "url":"^http://mwbunko\\.com/search/", | |
| "pageElement":"id('table_box')//tr[td]", | |
| "nextLink":"//span[@class='active']/following-sibling::span[1]/a", | |
| "wedata.net.id":55543 | |
| }, | |
| { | |
| "url":"^http://[^.]+\\.seesaa\\.net/", | |
| "insertBefore":"id(\"content\")/div[last()]", | |
| "pageElement":"id(\"content\")/div[contains(concat(\" \",@class,\" \"),\" blog \")]", | |
| "nextLink":"id(\"content\")/div[@class=\"navi\"]//a[contains(text(), \">>\") or contains(text(),\"\u6b21\")]", | |
| "wedata.net.id":1735 | |
| }, | |
| { | |
| "url":"^http://raw\\.senmanga\\.com/", | |
| "pageElement":"id(\"reader\")/a[img]", | |
| "nextLink":"//span[text()=\"Next Page\" or text()=\"Next Chapter\"]/parent::a", | |
| "wedata.net.id":76331 | |
| }, | |
| { | |
| "url":"^http://[^./]+\\.otaden\\.jp/", | |
| "pageElement":"id(\"content\")/div[@class=\"blog\"]/*[@class=\"blogbody\" or contains(@class,\"title\") or @class=\"date\" or self::h2 or self::hr or self::br]", | |
| "nextLink":"//div[@class=\"menu_left\" or @class=\"menu\"]//a[((starts-with(@href,\"/e\") or starts-with(@href,\"e\")) and contains(.,\"\u524d\")) or (contains(@href,\"index\") and contains(.,\"\u6b21\"))]", | |
| "wedata.net.id":55445 | |
| }, | |
| { | |
| "url":"^https://sourceforge\\.net/p/", | |
| "pageElement":"id('comment')/ul/li | //table[@class='ticket-list' or @class='forum-list clear']/tbody/tr", | |
| "nextLink":"//a[.='>']", | |
| "wedata.net.id":66802 | |
| }, | |
| { | |
| "url":"^http://vous\\.moo\\.jp/f/TSa", | |
| "pageElement":"//div/a|//p/a", | |
| "nextLink":"id(\"Layer1\")/a|//p/a", | |
| "wedata.net.id":55372 | |
| }, | |
| { | |
| "url":"^http://www\\.my18tube\\.com/", | |
| "pageElement":"id(\"content\")/descendant::div[contains(concat(\" \", @class, \" \"), \" video_box \") or contains(concat(\" \", @class, \" \"), \" album_box \") or contains(concat(\" \", @class, \" \"), \" photo_row \") or contains(concat(\" \", @class, \" \"), \" user-box \")]", | |
| "nextLink":"//div[contains(concat(\" \", @class, \" \"), \" pagination \")]/ul/li[contains(concat(\" \", span/@class, \" \"), \" currentpage \")]/following-sibling::li[1]/a", | |
| "wedata.net.id":66809 | |
| }, | |
| { | |
| "url":"^http://simpledesktops\\.com/", | |
| "pageElement":"//div[contains(concat(\" \", @class, \" \"), \" edge \")][child::div[@class=\"desktop\"]]", | |
| "nextLink":"//a[@class=\"more\" or @class=\"back\"]", | |
| "wedata.net.id":55318 | |
| }, | |
| { | |
| "url":"^http://www\\.phppro\\.jp/qa/", | |
| "pageElement":"id('q_list')/li", | |
| "nextLink":"//a[@title='次の50件']", | |
| "wedata.net.id":29053 | |
| }, | |
| { | |
| "url":"^http://www\\.boysfood\\.com/", | |
| "pageElement":"//div[contains(concat(\" \", @class, \" \"), \" page1 \")]/following-sibling::*[following-sibling::div[contains(concat(\" \", @class, \" \"), \" page1 \")]]", | |
| "nextLink":"//div[contains(concat(\" \", @class, \" \"), \" page1 \")]/div[contains(concat(\" \", @class, \" \"), \" page4 \") and child::b]/following-sibling::div[1]/a", | |
| "wedata.net.id":55986 | |
| }, | |
| { | |
| "url":"^http://\\w+\\.engrish\\.com/", | |
| "pageElement":"id(\"content\")/div[@class=\"apost\"]", | |
| "nextLink":"//a[text()='Next >']", | |
| "wedata.net.id":31204 | |
| }, | |
| { | |
| "url":"^http://kzho\\.net/jlab-giga/", | |
| "pageElement":"id(\"main\")/div[@class=\"control_panel\"]/preceding-sibling::*|//div[@class=\"article\"]", | |
| "nextLink":"//ul[@class=\"pager\"]//li[./span or ./a[@class=\"now\"]]/following-sibling::li[1]/a", | |
| "wedata.net.id":80659 | |
| }, | |
| { | |
| "url":"^http://www\\.appbrain\\.com/", | |
| "pageElement":"//div[@class='vmargin-s']", | |
| "nextLink":"//div[@class='paging']/span/following-sibling::a[1]", | |
| "wedata.net.id":31845 | |
| }, | |
| { | |
| "url":"^http://www\\.porn\\.to/\\w+/", | |
| "pageElement":"//div[contains(concat(\" \", @class, \" \"), \" items \")]", | |
| "nextLink":"//div[contains(concat(\" \", @class, \" \"), \" paging \")]/span[contains(concat(\" \", @class, \" \"), \" current \")]/following-sibling::span[1]/a", | |
| "wedata.net.id":56039 | |
| }, | |
| { | |
| "url":"^http://www\\.politico\\.com/", | |
| "pageElement":"//div[@class='story-text ']/p|//ul[@class='story-frag-list layout-grid grid-3' or @class='main-stories-list']/li", | |
| "nextLink":"//*[@class='pagination']//li[@class='current']/following-sibling::li[1]/a", | |
| "wedata.net.id":31169 | |
| }, | |
| { | |
| "url":"^http://www\\.j-tokkyo\\.com/", | |
| "pageElement":"//table[@class=\"list_table\"]", | |
| "nextLink":"id(\"content\")/strong/following-sibling::a[1]", | |
| "wedata.net.id":1851 | |
| }, | |
| { | |
| "url":"^http://blog\\.esuteru\\.com/", | |
| "pageElement":"//article[@class='clearfix']/section[last()]/preceding-sibling::section", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":67006 | |
| }, | |
| { | |
| "url":"^https?://\\w+\\.vareni\\.cz/", | |
| "pageElement":"id(\"searched-recipes last-articles dictionary-top\")[ancestor::div[@id=\"content\"]]/descendant::ul/li[contains(concat(\" \", @class, \" \"), \" item \")]", | |
| "nextLink":"//a[@rel=\"Next\"]", | |
| "wedata.net.id":56040 | |
| }, | |
| { | |
| "url":"^http://upsidedowndogs\\.com/", | |
| "pageElement":"id('post')/div[starts-with(@class,'blogItem')]", | |
| "nextLink":"id('pagenav')[count(./a)>1 or ./a[@href='http://upsidedowndogs.com/page/2/']]/a[last()]", | |
| "wedata.net.id":2854 | |
| }, | |
| { | |
| "url":"^http://osatomi\\.jugem\\.jp/", | |
| "pageElement":"//div[@class='entry']", | |
| "nextLink":"id('entryNavi')[count(a)>1 or a/@href='http://osatomi.jugem.jp/?page=1']/a[last()]", | |
| "wedata.net.id":37871 | |
| }, | |
| { | |
| "url":"^http://mediamarker\\.net/u/.", | |
| "pageElement":"//td[@class=\"main\"]/div[@class=\"binder_data\"]", | |
| "nextLink":"//div[@class=\"navi_search_top\"]/a[text()=\"次へ\"]", | |
| "wedata.net.id":1123 | |
| }, | |
| { | |
| "url":"^http://www\\.slutload\\.com/", | |
| "pageElement":"//div[contains(concat(\" \", @class, \" \"), \"thumbContainer\")]/div[@class=\"eachThumb\"] | id(\"content\")/descendant::ul[contains(concat(\" \", @class, \" \"), \" items \")]rnrnrn ", | |
| "nextLink":" //span[@class=\"pagi-next\"]/a | //div[contains(concat(\" \", @class, \" \"), \" paginator \")]/a[contains(concat(\" \", @class, \" \"), \" current \")]/following-sibling::a[1]", | |
| "wedata.net.id":55215 | |
| }, | |
| { | |
| "url":"^http://www\\.phileweb\\.com/", | |
| "pageElement":"//div[@class='newsbody']/node()", | |
| "nextLink":"id('pagenext')/a", | |
| "wedata.net.id":26632 | |
| }, | |
| { | |
| "url":"^http://www\\.leboncoin\\.fr/", | |
| "pageElement":"id('listingAds')/section/ul/li", | |
| "nextLink":"id('next')", | |
| "wedata.net.id":55198 | |
| }, | |
| { | |
| "url":"^.+://[^/]+\\.tumblr\\.com/.*", | |
| "pageElement":"//*[contains(concat(' ', @class, ' '), ' hentry ')]", | |
| "nextLink":"(//link|//a)[contains(concat(' ', translate(normalize-space(@rel),'NEXT','next'), ' '), ' next ')]", | |
| "wedata.net.id":31114 | |
| }, | |
| { | |
| "url":"^http://blogos\\.com/article/", | |
| "pageElement":"//div[@class=\"blogos_article\"]", | |
| "nextLink":"//ol[@class=\"pager\"]/li/a[@class=\"next\"]", | |
| "wedata.net.id":56781 | |
| }, | |
| { | |
| "url":"^http://www\\.vosbooks\\.net/", | |
| "pageElement":"//div[@class='cover_global']", | |
| "nextLink":"//a[.='>']rn", | |
| "wedata.net.id":74955 | |
| }, | |
| { | |
| "url":"^http://www\\.hotpepper\\.jp/", | |
| "pageElement":"//div[starts-with(@class,'shopDetailWrap')]", | |
| "nextLink":"//li[@class='crt']/following-sibling::li[1]/a", | |
| "wedata.net.id":2715 | |
| }, | |
| { | |
| "url":"^http://www\\.ansin-jp\\.com/", | |
| "pageElement":"//form/table[contains(@background,'bg.gif')]|//form/table[contains(@background,'bg.gif')]/following-sibling::br[1]", | |
| "nextLink":"//a[contains(.,'次')]", | |
| "wedata.net.id":65171 | |
| }, | |
| { | |
| "url":"^http://www\\.smh\\.com\\.au/", | |
| "pageElement":"//div[@class='cT-searchResult cfix']", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":29092 | |
| }, | |
| { | |
| "url":"^http://[^./]+\\.sbazar\\.cz/", | |
| "pageElement":"id('mrEggsResults')/*", | |
| "nextLink":"id('nextMrEggsLoader')", | |
| "wedata.net.id":57122 | |
| }, | |
| { | |
| "url":"^http://forums\\.opera\\.com/", | |
| "pageElement":"//table[not(@id='OriginalPost')]/tbody/tr", | |
| "nextLink":"//a[@class='Next']", | |
| "wedata.net.id":827 | |
| }, | |
| { | |
| "url":"^https://c\\.bunfree\\.net/c/", | |
| "pageElement":"//div[.//div/@class='pull-right']/following-sibling::div[following-sibling::div/@class='pull-right']", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":76309 | |
| }, | |
| { | |
| "url":"^http://www\\.porntube\\.com/", | |
| "pageElement":"//div[contains(@class,\"grid-col4\")]", | |
| "nextLink":"id('next')", | |
| "wedata.net.id":57131 | |
| }, | |
| { | |
| "url":"^http://nekoshota\\.com/blog/", | |
| "pageElement":"id(\"content\")/*[following-sibling::div[contains(concat(\" \",@class,\" \"),\" navlink \")]]", | |
| "nextLink":"//div[contains(concat(\" \",@class,\" \"),\" navlink \")]/a[contains(.,\"Older Posts\")]", | |
| "wedata.net.id":57156 | |
| }, | |
| { | |
| "url":"^http://galapagosstore\\.com/", | |
| "pageElement":"//ul[@class='item-01-list-wrap']/div/li", | |
| "nextLink":"//div[@class='pager-next pager-btn-color']//a", | |
| "wedata.net.id":41781 | |
| }, | |
| { | |
| "url":"^https?://[^?#]+/browse\\.php", | |
| "pageElement":"//table[tbody/tr/td[text()=\"Name\"]] | //table[tbody/tr/td/a[text()=\"Name\"]]", | |
| "nextLink":"//a[starts-with(b/text(), \"Next\")]", | |
| "wedata.net.id":30975 | |
| }, | |
| { | |
| "url":"^http://www\\.imagefap\\.com/", | |
| "pageElement":"id(\"gallery\")/form", | |
| "nextLink":"//a[(text()=\":: next ::\")]", | |
| "wedata.net.id":37448 | |
| }, | |
| { | |
| "url":"^https://speakerdeck\\.com/.+", | |
| "pageElement":"//div[@class='talk public']", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":77646 | |
| }, | |
| { | |
| "url":"^http://cinema\\.pia.co\\.jp/", | |
| "pageElement":"//ul[@class='commonMovieList']/li", | |
| "nextLink":"//a[@title='next page']", | |
| "wedata.net.id":751 | |
| }, | |
| { | |
| "url":"^http://www\\.oopsmovs\\.com/", | |
| "pageElement":"id('left-column-wide')", | |
| "nextLink":"id('pagination')/ul/li[contains(concat(' ', a/@class, ' '), ' active ')]/following-sibling::li[1]/a", | |
| "wedata.net.id":67270 | |
| }, | |
| { | |
| "url":"^http://(www\\.)?anican\\.jp/", | |
| "pageElement":"//div[@class='inner']|id('news-list-area')/ul/a|//div[@class='movie-archive-area']//li|id('main2Column')/div[@id='animeList']/*[not(@class='navi')]", | |
| "nextLink":"//a[li/@class='next'][not(ancestor::div/@id='leftColumn')]|//li[@class='next']/a|//div[@class='more-next-see-button']/a", | |
| "wedata.net.id":64924 | |
| }, | |
| { | |
| "url":"^http://wotskins\\.ucoz\\.ru/", | |
| "pageElement":"//div[contains(concat(' ', @class, ' '), ' block-bgr ')]/*[self::hr or self::table or self::br]", | |
| "nextLink":"//span[contains(concat(' ', @class, ' '), ' pagesBlockuz1 ')]/a[.='»']", | |
| "wedata.net.id":54518 | |
| }, | |
| { | |
| "url":"^http://angel-cup\\.ch2\\.cc/", | |
| "pageElement":"//div[@class=\"list\"]/table//tr[./td]", | |
| "nextLink":"//div[@class=\"pcbar\"]/a[last()][not(contains(@href,\"#\"))]", | |
| "wedata.net.id":77484 | |
| }, | |
| { | |
| "url":"^http://jp\\.ibtimes\\.com/.+", | |
| "pageElement":"//ul[@class='archive-list']/li", | |
| "nextLink":"//li[@class='pager-next last']/a", | |
| "wedata.net.id":2855 | |
| }, | |
| { | |
| "url":"^http://www\\.monotaro\\.com/", | |
| "pageElement":"//div[contains(@class,\"variation_item\")]", | |
| "nextLink":"//a[@class=\"page_next\"]", | |
| "wedata.net.id":26743 | |
| }, | |
| { | |
| "url":"^http://dev\\.rsaga\\.org/up/", | |
| "pageElement":"id(\"files\")/tbody/tr[not(th)]", | |
| "nextLink":"id(\"links\")/a[@class=\"pageall\"]/following-sibling::text()[normalize-space(self::text())]/following-sibling::a", | |
| "wedata.net.id":33225 | |
| }, | |
| { | |
| "url":"^http://www\\.sankeibiz\\.jp/", | |
| "insertBefore":"id(\"NewsDetail\")/div[@class=\"PageNavigation\"]", | |
| "pageElement":"id(\"NewsDetail\")/div[@class=\"TextArea\"]", | |
| "nextLink":"id(\"NewsDetail\")/div[@class=\"PageNavigation\"]/ul/li[last()]/a", | |
| "wedata.net.id":30862 | |
| }, | |
| { | |
| "url":"^http://penguinlab\\.jp/blog/", | |
| "pageElement":"//article", | |
| "nextLink":"//a[@rel='prev']", | |
| "wedata.net.id":37352 | |
| }, | |
| { | |
| "url":"^http://www\\.popoptiq\\.com/", | |
| "pageElement":"//div[@class='td-block-row']", | |
| "nextLink":"//a[i/@class='td-icon-menu-right']", | |
| "wedata.net.id":77266 | |
| }, | |
| { | |
| "url":"^http://www\\.fotoblur\\.com/", | |
| "pageElement":"id(\"divImages divCommunityFavs\")/div", | |
| "nextLink":"id(\"pPager\")/descendant::a[.=\"next\"]", | |
| "wedata.net.id":58505 | |
| }, | |
| { | |
| "url":"^http://www\\.zkaiblog\\.com/", | |
| "pageElement":"//ul[@class='entryList']/li", | |
| "nextLink":"//li[@class='follow']/a", | |
| "wedata.net.id":27873 | |
| }, | |
| { | |
| "url":"^http://blog\\.sketchup\\.com", | |
| "pageElement":"//div[@class=\"view-content\"]//li", | |
| "nextLink":"//li[@class=\"pager-next first last\"]/a|//ul[@class=\"pagination\"]/li[contains(@class,\"active\")]/following-sibling::li[1]/a", | |
| "wedata.net.id":79965 | |
| }, | |
| { | |
| "url":"^(http|https)://nijie\\.info/", | |
| "pageElement":"id(\"main-left-main\")/descendant::div[contains(concat(\" \", @class, \" \"), \" nijie \") or contains(concat(\" \", @class), \" nijie-\")]|id(\"kobetu-center\")/parent::div/*|id(\"main-left-none\")/*", | |
| "nextLink":"//div[contains(concat(\" \", @class, \" \"), \" motto-r \") or contains(concat(\" \", @class, \" \"), \" right \")]/p[contains(concat(\" \", @class, \" \"), \" page_button \")]/a|id(\"backIllust\")", | |
| "wedata.net.id":59142 | |
| }, | |
| { | |
| "url":"^http://.+\\.kenko\\.com/prod", | |
| "pageElement":"id('searchItemList')/*", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":54448 | |
| }, | |
| { | |
| "url":"^http://www\\.orgasmx\\.com/.", | |
| "pageElement":"id(\"content\")/div[contains(concat(\" \", @class, \" \"), \" column \")]/ul[starts-with(@class,\"list\")]", | |
| "nextLink":"//div[contains(concat(\" \", @class, \" \"), \" pager \")]/span/a[contains(concat(\" \", @class, \" \"), \" active \")]/following-sibling::a", | |
| "wedata.net.id":59436 | |
| }, | |
| { | |
| "url":"^http://www\\.mbga\\.jp/_game", | |
| "pageElement":"//li[@class='listGameItem']", | |
| "nextLink":"//a[@class='pagerNext']", | |
| "wedata.net.id":27734 | |
| }, | |
| { | |
| "url":"^http://a\\.hatena\\.ne\\.jp/", | |
| "pageElement":"//div[@class='curve-middle']/ol/li", | |
| "nextLink":"//a[@class='navi_next']", | |
| "wedata.net.id":704 | |
| }, | |
| { | |
| "url":"^http://f\\.hatena\\.ne\\.jp/", | |
| "pageElement":"//ul[@class='fotolist']/li | //div[@class=\"foto-body\"]", | |
| "nextLink":"//a[.='next>']", | |
| "wedata.net.id":699 | |
| }, | |
| { | |
| "url":"^http://book\\.cakephp\\.org/", | |
| "pageElement":"//div[@class=\"body\"]", | |
| "nextLink":"//link[@rel=\"next\"]", | |
| "wedata.net.id":1951 | |
| }, | |
| { | |
| "url":"^http://jisaku\\.155cm\\.com/", | |
| "pageElement":"//hr/following-sibling::table", | |
| "nextLink":"//hr/following-sibling::b/following-sibling::a[1]", | |
| "wedata.net.id":54439 | |
| }, | |
| { | |
| "url":"^http://www\\.voiceblog\\.jp/", | |
| "pageElement":"//div[@class=\"content_box\"]", | |
| "nextLink":"//div[@class=\"content_next\"]/a", | |
| "wedata.net.id":2681 | |
| }, | |
| { | |
| "url":"^http://idolmaster\\.jp/blog/", | |
| "pageElement":"id(\"contents\")/div[@class=\"entryCol\"]", | |
| "nextLink":"//a[@class=\"nextpostslink\"]", | |
| "wedata.net.id":77432 | |
| }, | |
| { | |
| "url":"^http://g86\\.dbcls\\.jp/g86/", | |
| "pageElement":"//div[@class=\"content clearfix\"]|//h6", | |
| "nextLink":"//link[@rel=\"prev\"]", | |
| "wedata.net.id":36624 | |
| }, | |
| { | |
| "url":"^http://123freevectors\\.com/", | |
| "pageElement":"//div[@class='post-thumb']/*", | |
| "nextLink":"//a[class='nextpostslink' or ../@class='nav-previous']", | |
| "wedata.net.id":26384 | |
| }, | |
| { | |
| "url":"^https?://blog\\.prezi\\.com/", | |
| "pageElement":"//div[@class=\"offset-grid\"]/div", | |
| "nextLink":"//a[@class=\"next page-numbers\"]", | |
| "wedata.net.id":36165 | |
| }, | |
| { | |
| "url":"^http://cmsthemefinder\\.com/", | |
| "pageElement":"//ul[@class=\"theme_list\"]/li", | |
| "nextLink":"//div[@class=\"next\"]/a", | |
| "wedata.net.id":32247 | |
| }, | |
| { | |
| "url":"^http://appspot\\.jgate\\.de/", | |
| "pageElement":"//table[descendant::*[@class=\"rowPadding\"]]", | |
| "nextLink":"//div[@class=\"cursor-more\"]/a[text()=\"Next\"]", | |
| "wedata.net.id":33288 | |
| }, | |
| { | |
| "url":"^http://videosabout\\.cooking", | |
| "pageElement":"//div[@class=\"news-block\"]", | |
| "nextLink":"//li[@class=\"active\"][count(./following-sibling::li)>1]/following-sibling::li[1]/a", | |
| "wedata.net.id":77653 | |
| }, | |
| { | |
| "url":"^http://www\\.celebuzz\\.com/", | |
| "pageElement":"//div[@class=\"feed feed-large-image\"]", | |
| "nextLink":"//div[@class=\"col-sm-4 next \"]/a[@class=\"pag-arrow\"]", | |
| "wedata.net.id":77659 | |
| }, | |
| { | |
| "url":"^http://www\\.gocomics\\.com/", | |
| "pageElement":"//div[@class='feature']/*[self::h1 or @class='feature-nav' or @class='feature_item']", | |
| "nextLink":"//a[@class='next' and .='Next feature']", | |
| "wedata.net.id":74786 | |
| }, | |
| { | |
| "url":"^http://freerangestock\\.com/", | |
| "pageElement":"//body//tr[td[@style]//@class='thumb']", | |
| "nextLink":"//span[@class=\"current\"]/following-sibling::a[1]", | |
| "wedata.net.id":26381 | |
| }, | |
| { | |
| "url":"^http://www\\.vecteezy\\.com/", | |
| "pageElement":"//ul[@class=\"grid items\"]", | |
| "nextLink":"//a[@class=\"next_page\"]", | |
| "wedata.net.id":687 | |
| }, | |
| { | |
| "url":"^http://www\\.cyzowoman\\.com", | |
| "pageElement":"id('archiveEntries')/div[@class='archiveEntry']|id('entryBody')/*", | |
| "nextLink":"//a[@class='link_next']", | |
| "wedata.net.id":77605 | |
| }, | |
| { | |
| "url":"^https?://www\\.health\\.com/", | |
| "pageElement":"id('article-content')/node()[following-sibling::div/@class='next-page-link' or not(//div/@class='next-page-link')]", | |
| "nextLink":"//a[@title='Next Page']", | |
| "wedata.net.id":2592 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?rara\\.jp/", | |
| "pageElement":"//center/*[self::table or self::br/following-sibling::br[last()-1]]", | |
| "nextLink":"//div[@style='font-size:13px;margin-bottom:4px;'][count(a)=2 or (count(a)=1 and a/@href='link2')]/a[last()]", | |
| "wedata.net.id":29274 | |
| }, | |
| { | |
| "url":"^http://www\\.ehmatome\\.com/", | |
| "pageElement":"//div[@class=\"result\"]/table/tbody/tr", | |
| "nextLink":"//div[@class=\"paginationControl\"]/span/following-sibling::a[1]|//div[@class=\"paginationControl\"]/text()[string-length(normalize-space()) > 4]/following-sibling::a", | |
| "wedata.net.id":74991 | |
| }, | |
| { | |
| "url":"^http://www\\.100shiki\\.com/", | |
| "pageElement":"//div[@class='post']", | |
| "nextLink":"//a[@class='next page-numbers']", | |
| "wedata.net.id":32364 | |
| }, | |
| { | |
| "url":"^http://www\\.photodom\\.com/", | |
| "pageElement":"id(\"photos_plate folder_plate\")/div[@class=\"main_div\"]|id(\"rightColumn\")/div[5]", | |
| "nextLink":"//span[@class=\"pager_in\"]/following-sibling::span[@class=\"pager_out\"]/a", | |
| "wedata.net.id":60734 | |
| }, | |
| { | |
| "url":"^http://myhome\\.nifty\\.com/", | |
| "pageElement":"id(\"searchResultItems\")/table[not(@style)][1]/tbody/tr", | |
| "nextLink":"//li[@class=\"mg1 current\"]/following-sibling::li[1]/a", | |
| "wedata.net.id":64706 | |
| }, | |
| { | |
| "url":"^http://www\\.adweek\\.com/.+", | |
| "pageElement":"//div[@class='col colB']/div[starts-with(@id,'node-')]|//div[@class='posts']/node()|//div[@class='x-filterable-category-group selected']/article", | |
| "nextLink":"//li[starts-with(*/@class,'current')]/following-sibling::li[1]/a", | |
| "wedata.net.id":74719 | |
| }, | |
| { | |
| "url":"^http://media\\.yucasee\\.jp/", | |
| "pageElement":"//div[@class='whbox articles']|//ul[@class='list01 mb30 firstChild']/li", | |
| "nextLink":"//li[starts-with(@class,'nowpage')]/following-sibling::li[1]/a", | |
| "wedata.net.id":27023 | |
| }, | |
| { | |
| "url":"^http://creative-video\\.info", | |
| "pageElement":"//div[@class=\"row main\"]/div[@class=\"row\"][not(.//div[@id=\"fb-root\"])]", | |
| "nextLink":"//a[@rel=\"next\"]|//link[@rel=\"next\"]", | |
| "wedata.net.id":77181 | |
| }, | |
| { | |
| "url":"^https://(?:en\\.)?osdn\\.jp/", | |
| "pageElement":"//div[@class='internal' or @class='external']|//div[@class='page-link-bottom']/preceding-sibling::*|id('contents')/article|id('left-column')/table//tr[td]|id('left-column')/h3[1]/following-sibling::*[following-sibling::ul]", | |
| "nextLink":"//div[@class='paging_nav_bar_next']/a|//div[@class='pagination']//li[@class='active']/following-sibling::li[1][not(@class='disabled')]/a|//div[@class='pagination-link'][count(a)>1 or a/@href='https://osdn.jp/magazine/page/2']/a[last()]|//ul[@class='pager'][count(li)>1 or li/a/@href='?type=downloads_day&offset=50']/li[last()]/a|//link[@rel='next']", | |
| "wedata.net.id":77283 | |
| }, | |
| { | |
| "url":"^http://asia\\.nikkei\\.com/.", | |
| "pageElement":"//div[@class='article-box text-list']//li|//div[@class='article-box detail']/*", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":80863 | |
| }, | |
| { | |
| "url":"https://www\\.360nobs\\.com/.", | |
| "pageElement":"//div[@class='module-blog-wrap']/div", | |
| "nextLink":"//a[@class='next page-numbers']", | |
| "wedata.net.id":80864 | |
| }, | |
| { | |
| "url":"^http://rutile-official\\.jp/", | |
| "pageElement":"//div[@class='article']", | |
| "nextLink":"//a[@class='nextpostslink'] | //link[@rel='prev' and contains(@href,'/blog/')] | id('blog_archive')/dd/ul/li[@class='current-date' or (a[@href = //a[@class='previouspostslink']/@href])]/following-sibling::li[1]/a", | |
| "wedata.net.id":64689 | |
| }, | |
| { | |
| "url":"^https?://lwn\\.net/Articles/", | |
| "pageElement":"//div[@class=\"ArticleText\"]/ul[./li/a[contains(., \"Next\")]][last()]/preceding-sibling::*[not(self::ul and ./li/a[contains(., \"Previous\")])]", | |
| "nextLink":"(//div[@class=\"ArticleText\"]/ul/li/a[contains(., \"Next\")])[last()]", | |
| "wedata.net.id":658 | |
| }, | |
| { | |
| "url":"^http://www\\.zaeega\\.com/.*", | |
| "pageElement":"//div[@class='archives-entry']", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":61254 | |
| }, | |
| { | |
| "url":"http://pro\\.boxoffice\\.com/", | |
| "pageElement":"id('main')/div/div", | |
| "nextLink":"//a[@class='next page-numbers']", | |
| "wedata.net.id":74716 | |
| }, | |
| { | |
| "url":"^http://c\\.filesend\\.to/ct/", | |
| "pageElement":"//div[@class=\"main-content\"][//link[@rel=\"next\"]]", | |
| "nextLink":"//link[@rel='next']", | |
| "wedata.net.id":77007 | |
| }, | |
| { | |
| "url":"^http://www\\.menscyzo\\.com/", | |
| "pageElement":"id('alpha-inner')//div[starts-with(@class,'subEntry')]", | |
| "nextLink":"//a[@class='link_next']", | |
| "wedata.net.id":74996 | |
| }, | |
| { | |
| "url":"^http://www\\.animenova\\.org", | |
| "pageElement":"//div[@class='series_list'] | //div[@id='videos']/ul", | |
| "nextLink":"//a[.='Next']", | |
| "wedata.net.id":77012 | |
| }, | |
| { | |
| "url":"^http://www\\.0daydown\\.com/", | |
| "pageElement":"//article", | |
| "nextLink":"//li[@class='next-page']/a", | |
| "wedata.net.id":77421 | |
| }, | |
| { | |
| "url":"^https?://www\\.lancers\\.jp/", | |
| "pageElement":"//section[@class='corner']/article|//div[table/@class='img_box' or @class='suggestion_box float_left ']|//ul[@class='work_list search' or @class='search-cassettes']/li", | |
| "nextLink":"//a[(.|..)/@class='next']", | |
| "wedata.net.id":35464 | |
| }, | |
| { | |
| "url":"^http://www\\.thescore\\.com/", | |
| "pageElement":"//div[@class=\"article-list\"]", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":77844 | |
| }, | |
| { | |
| "url":"^http://next\\.rikunabi\\.com", | |
| "pageElement":"//div[@class=\"new-contents\"]", | |
| "nextLink":"//div[@class=\"pager\"]/a[@class=\"next\"]", | |
| "wedata.net.id":61444 | |
| }, | |
| { | |
| "url":"^http://jp\\.misumi-ec\\.com/", | |
| "pageElement":"//ul[@class='list']/li", | |
| "nextLink":"id('search_pager_lower_right')/a", | |
| "wedata.net.id":26222 | |
| }, | |
| { | |
| "url":"^http://www\\.metacafe\\.com/", | |
| "pageElement":"id('list_videos_most_recent_videos')/form/div[@class='mc-cl mc-preview']", | |
| "nextLink":"//li[@class='next mc-pagination-mobile']/a", | |
| "wedata.net.id":32746 | |
| }, | |
| { | |
| "url":"^http://www\\.zeit\\.de/suche", | |
| "pageElement":"//article", | |
| "nextLink":"//a[@class='pager__button pager__button--next']", | |
| "wedata.net.id":61707 | |
| }, | |
| { | |
| "url":"^http://ototoy\\.jp/features/", | |
| "pageElement":"//div[@class='row clearfix']/div", | |
| "nextLink":"//a[@title=\"next page\"]", | |
| "wedata.net.id":77294 | |
| }, | |
| { | |
| "url":"^http://content\\.time\\.com/", | |
| "pageElement":"//div[@class='entry-content group']/p[not(span[starts-with(.,'(')])]", | |
| "nextLink":"//li[span/@class='page current']/following-sibling::li/a[1]", | |
| "wedata.net.id":2555 | |
| }, | |
| { | |
| "url":"^http://www\\.flaticon\\.com/", | |
| "pageElement":"//ul[@class='icons']/li", | |
| "nextLink":"id('pagination-more')", | |
| "wedata.net.id":76486 | |
| }, | |
| { | |
| "url":"^http://www\\.idolator\\.com/", | |
| "pageElement":"//div[@class='feed feed-large-image']/*", | |
| "nextLink":"//div[@class='col-sm-4 next ']/a", | |
| "wedata.net.id":77373 | |
| }, | |
| { | |
| "url":"^http://moodyz\\.org/($|page)", | |
| "pageElement":"//div[@class='art-layout-cell art-content']/div", | |
| "nextLink":"//a[(text()='« Older Entries')]", | |
| "wedata.net.id":80879 | |
| }, | |
| { | |
| "url":"^http://www\\.macworld\\.com/", | |
| "pageElement":"id(\"home-main-primary\")/div", | |
| "nextLink":"//a[@rel=\"next\"]|//p[@class=\"listing-footer\"]/a", | |
| "wedata.net.id":77830 | |
| }, | |
| { | |
| "url":"^http://blog\\.tatsuru\\.com/", | |
| "pageElement":"//div[@class=\"pkg\"]/*[self::div[@class=\"entry\"] or self::h2[@id=\"archive-title\"]]", | |
| "nextLink":"//*[contains(@class, \"module-archives\")][.//text()[contains(.,\"最近のエントリー\")]]//li[2]/a|//*[@class=\"content-nav\"]/a[1]", | |
| "wedata.net.id":64539 | |
| }, | |
| { | |
| "url":"^http://www\\.king-mag\\.com/", | |
| "pageElement":"id('content_main')/section/article|//div[@class='the_content clearfix']/p[*][not(@class='more_act post-pagination-buttons')]", | |
| "nextLink":"//a[@class='page_next' or @class='button_act alignright']", | |
| "wedata.net.id":2551 | |
| }, | |
| { | |
| "url":"^https://shop\\.cool3c\\.com/", | |
| "pageElement":"id('content-area')//ul[@class='product-serial']/li", | |
| "nextLink":"//li[@class='pager-next']/a", | |
| "wedata.net.id":73846 | |
| }, | |
| { | |
| "url":"^http://minimalexhibit\\.com/", | |
| "pageElement":"id(\"main\")/div[@class=\"excerpt\"]", | |
| "nextLink":"//div[@class=\"wp-pagenavi\"]/a[@class=\"nextpostslink\"]", | |
| "wedata.net.id":41011 | |
| }, | |
| { | |
| "url":"^http://www\\.gigafree\\.net/", | |
| "pageElement":"//div[contains(@class,\"sni\") or contains(@class,\"detail\") or contains(@id,\"line\")]", | |
| "nextLink":"//span[@class=\"idx\"]/following-sibling::a[1]", | |
| "wedata.net.id":77554 | |
| }, | |
| { | |
| "url":"^http://mediaarts-db\\.jp/an/", | |
| "pageElement":"//section/table//tr[td]", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":77040 | |
| }, | |
| { | |
| "url":"^http://www\\.gamespot\\.com/", | |
| "pageElement":"(//ul[starts-with(@class,'paginate')]|//div[@class='navigation navigation--is-gamesList'])/preceding-sibling::*/*[@class='media' or self::article or self::section or @class='pod-header ']|//div[@class='image-gallery__footer']/preceding-sibling::*|id('forum-content')//*[tr/td or starts-with(div/@id,'js-message')]", | |
| "nextLink":"//li[@class='paginate__item skip next' or @class='paginate__item paginate-simple__prev' ]/a|//a[@title='Next Image']", | |
| "wedata.net.id":32471 | |
| }, | |
| { | |
| "url":"^http://hellogiggles\\.com/.+", | |
| "pageElement":"//div[@class='plist v-loop']//li|//div[starts-with(@class,'post-pagination-bottom')]/preceding-sibling::*", | |
| "nextLink":"//*[@class='blogroll' or @class='entry-content']//a[@class='more']", | |
| "wedata.net.id":77518 | |
| }, | |
| { | |
| "url":"^http://3ds\\.culdcept\\.com/", | |
| "pageElement":"id('contents')|//div[@class='culdcept-faq-list']/div", | |
| "nextLink":"//link[@rel='next']|//a[@class='next page-numbers']", | |
| "wedata.net.id":62400 | |
| }, | |
| { | |
| "url":"^https://novel.syosetu\\.org/", | |
| "pageElement":"//div[@class='section3']", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":62424 | |
| }, | |
| { | |
| "url":"^http://www\\.elle\\.co\\.jp/", | |
| "pageElement":"//li[@class=\"list-entry clearfix\"]", | |
| "nextLink":"//a[@class=\"arrow-right\"]", | |
| "wedata.net.id":31363 | |
| }, | |
| { | |
| "url":"^http://book\\.cakephp\\.org/", | |
| "pageElement":"id(\"body\")/div[contains(concat(\" \", @class, \" \"), \" view \")]", | |
| "nextLink":"id(\"body\")/div[@class=\"node-nav\"]/span[@class=\"next\"]/a", | |
| "wedata.net.id":25731 | |
| }, | |
| { | |
| "url":"^http://www\\.uukanshu\\.com/", | |
| "pageElement":"id(\"contentbox\")/node()|//div[@class=\"h1title\"]", | |
| "nextLink":"//div[@class='fanye_cen']/a[last()][not(@href=\"index.html\")]", | |
| "wedata.net.id":80937 | |
| }, | |
| { | |
| "url":"^http://itp\\.ne\\.jp/result/", | |
| "pageElement":"//div[@class='normalResultsBox']", | |
| "nextLink":"//li[@class='current']/following-sibling::li/a", | |
| "wedata.net.id":25860 | |
| }, | |
| { | |
| "url":"^http://www\\.its-mo\\.com/c/", | |
| "pageElement":"//ul[contains(@class,'searchList')]/li", | |
| "nextLink":"//div[@class='lst-pg']/span[@class='act']/following-sibling::a[1]", | |
| "wedata.net.id":29449 | |
| }, | |
| { | |
| "url":"^http://blog\\.kcg\\.ne\\.jp/", | |
| "pageElement":"id('listBox')/section/div", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":2126 | |
| }, | |
| { | |
| "url":"http://www\\.clickhole\\.com/", | |
| "pageElement":"id('content-list results')//div[contains(@class,'thumb-xs')]", | |
| "nextLink":"//a[@class='btn btn-default' or @title='Next']", | |
| "wedata.net.id":76385 | |
| }, | |
| { | |
| "url":"^http://s\\.etao\\.com/search", | |
| "pageElement":"id('mainview')/div[@class='main']/*", | |
| "nextLink":"//a[@class='pagination-next']", | |
| "wedata.net.id":73910 | |
| }, | |
| { | |
| "url":"^http://www\\.yamareco\\.com/", | |
| "pageElement":"//div[@class='block']", | |
| "nextLink":"//a[@class='pager_arrow_next01']", | |
| "wedata.net.id":34537 | |
| }, | |
| { | |
| "url":"^http://www\\.sakimura\\.org/", | |
| "pageElement":"id('topnews')/dl[@class='clearfix']|//div[@class='nextPageBtn']/preceding-sibling::*[preceding-sibling::h2]", | |
| "nextLink":"//link[@rel='next']|//div[@class='nextPageBtn']/a", | |
| "wedata.net.id":77309 | |
| }, | |
| { | |
| "url":"^http://www\\.mininova\\.org/", | |
| "pageElement":"//table[@class='maintable']//tr[td]", | |
| "nextLink":"id('pagination')//li[@class='current']/following-sibling::li[1]/a", | |
| "wedata.net.id":30178 | |
| }, | |
| { | |
| "url":"^http://www\\.etonline\\.com/", | |
| "pageElement":"//div[@class='latest-news thumb']", | |
| "nextLink":"//a[@rel='track_next']", | |
| "wedata.net.id":77058 | |
| }, | |
| { | |
| "url":"^https?://[^?]+?/namazu\\.cgi", | |
| "pageElement":"//dl/*", | |
| "nextLink":"//strong[.='Page:' or .='ペイジ:']/following-sibling::strong/following-sibling::a[1]", | |
| "wedata.net.id":2134 | |
| }, | |
| { | |
| "url":"^http://repadars\\.org/\\d{3}", | |
| "pageElement":"//pre/node()", | |
| "nextLink":"//a[contains(@href,'.html') and starts-with(@href,'5')]", | |
| "wedata.net.id":76407 | |
| }, | |
| { | |
| "url":"^http://www\\.sbnation\\.com/", | |
| "pageElement":"//div[@class='l-chunk']/div[starts-with(@class,'m-block')]|//div[@class='lookit-river-entries']/div", | |
| "nextLink":"//span[@class='m-pagination__next p-button ']/a|//a[@rel='next']", | |
| "wedata.net.id":77059 | |
| }, | |
| { | |
| "url":"^https://interfacelift\\.com/", | |
| "pageElement":"//div[starts-with(@id,'list_')]/parent::div/*", | |
| "nextLink":"//a[@class='selector'][contains(.,'>')]", | |
| "wedata.net.id":2533 | |
| }, | |
| { | |
| "url":"^http://suchen\\.mobile\\.de/", | |
| "pageElement":"//div[contains(@class,'resultitem')]", | |
| "nextLink":"//ul[@class='pagination']/li[text()][number()>0]/following-sibling::li[1]/a", | |
| "wedata.net.id":32695 | |
| }, | |
| { | |
| "url":"^http://www\\.ashinari\\.com/", | |
| "pageElement":"id('listPhoto')/ul/li[not(.//@style)]", | |
| "nextLink":"//a[img/@class='btn_pagenum_next' or contains(.,'>')]", | |
| "wedata.net.id":2516 | |
| }, | |
| { | |
| "url":"^https://www\\.meneame\\.net/", | |
| "pageElement":"//div[@class='news-summary']", | |
| "nextLink":"//span[@class='current']/following-sibling::a[1]", | |
| "wedata.net.id":32513 | |
| }, | |
| { | |
| "url":"^http://www\\.gamefaqs\\.com/", | |
| "pageElement":"//div[@class='ffaq ffaqbody']//div[@class='section' and not(contains(h2,'(Continued)')) or @class='section_box']|//table[starts-with(@class,'board topics tlist') or starts-with(@class,'board message') or @class='results']/tbody/tr", | |
| "nextLink":"//a[i/@class='fa fa-angle-right']", | |
| "wedata.net.id":74675 | |
| }, | |
| { | |
| "url":"^http://www\\.philstar\\.com/", | |
| "pageElement":"//table[@class='views-table cols-3']/tbody/tr|//div[@class='panel-pane pane-views pane-philstar-business-subsections pane-latest']//div[@class='view-content']/div", | |
| "nextLink":"//a[@title='Go to next page']", | |
| "wedata.net.id":77323 | |
| }, | |
| { | |
| "url":"https?://thehackernews\\.com/", | |
| "pageElement":"id('Blog1')/div[contains(@class,'blog-posts')]", | |
| "nextLink":"id('blog-pager-older-link')/a", | |
| "wedata.net.id":80969 | |
| }, | |
| { | |
| "url":"^http://2d?book\\.(?:jp|com)/", | |
| "pageElement":"//div[@class=\"contentbox\"]/div[@class=\"content\"]|//div[@class=\"itembox\"]/div[@class=\"item\"][contains(.//a/@href,\"books\")]", | |
| "nextLink":"//ul/li[@class=\"current\"]/following-sibling::li/a|//div[contains(@class,\"pagelist\")]/ul/li[@class=\"next\"]/a[@rel=\"next\"]", | |
| "wedata.net.id":62768 | |
| }, | |
| { | |
| "url":"^http://img\\.ly/(?!images/).", | |
| "pageElement":"id(\"main-content\")/node()", | |
| "nextLink":"//li[contains(concat(\" \", normalize-space(@class), \" \"), \" previous \")]/a", | |
| "wedata.net.id":34521 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?wpdb\\.de/", | |
| "pageElement":"id(\"table1\")/tbody/tr", | |
| "nextLink":"//a[@class=\"selected\"]/following-sibling::a[1]", | |
| "wedata.net.id":32602 | |
| }, | |
| { | |
| "url":"^http://[^/]+\\.tumblr\\.com/", | |
| "pageElement":"id(\"mason\")|//div[contains(concat(\" \",@class,\" \"),\" masonry \")]", | |
| "nextLink":"//a[contains(@href,\"/page/\")][number(substring-after(self::a/@href,\"/page/\"))-number(substring-after(preceding::a[contains(@href,\"/page/\")][1]/@href,\"/page/\")) = 2 or number(substring-after(self::a/@href,\"/page/\"))-number(substring-after(following::a[contains(@href,\"/page/\")][1]/@href,\"/page/\")) = 2]|//a[starts-with(@href,\"/page/\") or contains(@href,\"/search/\") or contains(@href,\"/tagged/\")][contains(@href,\"/page/2\")][number(substring-after(following::a[contains(@href,\"/page/\")][1]/@href,\"/page/\")) != 4 and number(substring-after(preceding::a[contains(@href,\"/page/\")][1]/@href,\"/page/\")) != 4]", | |
| "wedata.net.id":63728 | |
| }, | |
| { | |
| "url":"^https://.+\\.drupal\\.org/.+", | |
| "pageElement":"(//div[@class='block-inner']|id('search-results'))/div[contains(@class,'content')]/div[contains(@id,'node-') or starts-with(@class,'views')]", | |
| "nextLink":"//a[@title='Go to next page']", | |
| "wedata.net.id":448 | |
| }, | |
| { | |
| "url":"^https?://.+/(forum|thread).+", | |
| "pageElement":"(id('threadlist')|//div[starts-with(a/@id,'newspecial') or @class='pgs mtm mbm cl' or @class='mainbox threadlist'])//tbody[@id]|(id('postlist')|//div[@class='mainbox viewthread'])/div/table[starts-with(@id,'pid')][not(@class='plhin post_lz')]", | |
| "nextLink":"//a[@class='next' or @class='nxt']", | |
| "wedata.net.id":447 | |
| }, | |
| { | |
| "url":"^http://archive\\.treet\\.tv/", | |
| "pageElement":"id(\"main\")//div[@class=\"node\"]", | |
| "nextLink":"id(\"main\")//div[@class=\"pager\"]/a[contains(., \"next\")]", | |
| "wedata.net.id":2311 | |
| }, | |
| { | |
| "url":"^http://www\\.idea-mag\\.com/", | |
| "pageElement":"//div[@class='mbox']", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":63590 | |
| }, | |
| { | |
| "url":"^http://www\\.bestgate\\.net/", | |
| "pageElement":"id('search-list')/tbody/tr[td/@class='mall']", | |
| "nextLink":"//a[.='次の40件>']", | |
| "wedata.net.id":27389 | |
| }, | |
| { | |
| "url":"^https?://trending\\.report/.", | |
| "pageElement":"//div[@class='textadvertisement1']/following-sibling::*[following-sibling::*/@class='textadvertisement2']", | |
| "nextLink":"//a[@class='nextpostslink']", | |
| "wedata.net.id":80983 | |
| }, | |
| { | |
| "url":"^http://shop\\.kitamura\\.jp/", | |
| "pageElement":"id('itemList')/ul/li", | |
| "nextLink":"//li[@class='current']/following-sibling::li[1]/arn", | |
| "wedata.net.id":27385 | |
| }, | |
| { | |
| "url":"^http://[^.]+\\.cscblog\\.jp/", | |
| "pageElement":"//div[@class=\"main-center\"]/div[not(@style=\"font-size: 10pt; text-align: center;\")]", | |
| "nextLink":"//div[@style=\"font-size: 10pt; text-align: center;\"]/a[starts-with(text(), \"\u6b21\u3078\")]", | |
| "wedata.net.id":29760 | |
| }, | |
| { | |
| "url":"^http://www\\.venganza\\.org/", | |
| "pageElement":"//div[@class='postwrap']", | |
| "nextLink":"//span[@class='current']/following-sibling::a[1]", | |
| "wedata.net.id":41437 | |
| }, | |
| { | |
| "url":"^http://www\\.avclub\\.com/.+", | |
| "pageElement":"//div[@class='article-body needs-margin']/section/article", | |
| "nextLink":"//a[@class='next alt']", | |
| "wedata.net.id":27280 | |
| }, | |
| { | |
| "url":"^http://speakingjs\\.com/es5/", | |
| "pageElement":"id('page-content')/section/*", | |
| "nextLink":"//div[@class='next-chapter']/a", | |
| "wedata.net.id":74646 | |
| }, | |
| { | |
| "url":"^http://montrealpython\\.org/", | |
| "pageElement":"//article", | |
| "nextLink":"//a[@title='next']", | |
| "wedata.net.id":42127 | |
| }, | |
| { | |
| "url":"^http://id[0-9]*\\.fm-p\\.jp/", | |
| "pageElement":"//div[@style='background-color:#ffffcc;']/*", | |
| "nextLink":"//a[@title='next page']", | |
| "wedata.net.id":75032 | |
| }, | |
| { | |
| "url":"^http://www\\.gameonchi\\.me/", | |
| "pageElement":"id(\"content\")//div[@class=\"blog\"]/div[@class=\"blogbody\"]|id(\"content\")/div[@class=\"blog\"]/h2[@class=\"date\"]", | |
| "nextLink":"id(\"content\")//div[@class=\"navi\"]/a[contains(text(),\">>\")]", | |
| "wedata.net.id":63491 | |
| }, | |
| { | |
| "url":"^http://cgworld\\.jp/feature/", | |
| "pageElement":"//div[@class=\"article-body\"]", | |
| "nextLink":"//ul[@class=\"pageNav-num\"]/li[contains(concat(\" \",@class,\" \"),\" active \")]/following-sibling::li/a", | |
| "wedata.net.id":77715 | |
| }, | |
| { | |
| "url":"^http://[^.]+\\.indeed\\.com/", | |
| "pageElement":"id('resultsCol')/div[contains(@class,'row') or div[starts-with(@class,'row ')]]", | |
| "nextLink":"id('resultsCol')/div[@class='pagination']/b/following-sibling::a[1]", | |
| "wedata.net.id":32564 | |
| }, | |
| { | |
| "url":"^http://javeu\\.com/category/", | |
| "pageElement":"//div[@id=\"archive-posts\"]/*[not(@class=\"wp-pagenavi\")]", | |
| "nextLink":"//a[@class=\"nextpostslink\"]", | |
| "wedata.net.id":77710 | |
| }, | |
| { | |
| "url":"^http://www\\.suysing\\.com/", | |
| "pageElement":"//div[@class='category-item shadow']|//div[@class='updates-section shadow']/ul/li", | |
| "nextLink":"//li[@class='currentpage']/following-sibling::li[1]/a", | |
| "wedata.net.id":63368 | |
| }, | |
| { | |
| "url":"^http://www\\.3dmgame\\.com/", | |
| "pageElement":"//div[contains(@class,'con')]/div/div[@class='page_fenye']/preceding-sibling::*", | |
| "nextLink":"//div[@class='page_fenye']/div[@class='pagelistbox']/strong/following-sibling::a[1]", | |
| "wedata.net.id":77087 | |
| }, | |
| { | |
| "url":"^http://kancolle\\.x0\\.com/", | |
| "pageElement":"id('uploader)//tr", | |
| "nextLink":"//a[img/@alt='次へ']", | |
| "wedata.net.id":74368 | |
| }, | |
| { | |
| "url":"^http://dzfl\\.tumblr\\.com/", | |
| "pageElement":"//div[@class=\"chapter-container\"]", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":29587 | |
| }, | |
| { | |
| "url":"^http://blog\\.tenhou\\.net/", | |
| "pageElement":"//div[@class=\"blog\"]", | |
| "nextLink":"//div[@class=\"navi\"][last()][count(./a)>5 or //link[@media=\"handheld\"][contains(@href,\"category\")][contains(@href,\"-1\")]]/a[last()][//meta[@property=\"og:url\"][contains(@content,\"index\")] or //link[@media=\"handheld\"][contains(@href,\"category\")]]|//div[@class=\"navi\"][last()]/a[1][not(//meta[@property=\"og:url\"][contains(@content,\"index\")] or //link[@media=\"handheld\"][contains(@href,\"category\")])]", | |
| "wedata.net.id":77754 | |
| }, | |
| { | |
| "url":"^http://www\\.flatz\\.jp/\\?", | |
| "pageElement":"//ul[@class='main-articles-list']/li", | |
| "nextLink":"//p[@class='postsNavLink'][//meta[@property='og:url'][not(contains(@content,'page'))] or count(./a)>1]/a[last()]", | |
| "wedata.net.id":33132 | |
| }, | |
| { | |
| "url":"^http://.+\\.tutsplus\\.com/", | |
| "pageElement":"//ul[starts-with(@class,'posts')]/li", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":817 | |
| }, | |
| { | |
| "url":"^http://ure\\.pia\\.co\\.jp/", | |
| "pageElement":"//ul[@class='list list_border']/li|//div[@id='pagenation']/preceding-sibling::*", | |
| "nextLink":"//a[@class='btn_default btn_next' or ../@class='pagenation_next']", | |
| "wedata.net.id":63335 | |
| }, | |
| { | |
| "url":"^http://carolinesmode\\.com/", | |
| "pageElement":"//ul[@class='grid-layout']/*", | |
| "nextLink":"//div[@class='older']/a", | |
| "wedata.net.id":46490 | |
| }, | |
| { | |
| "url":"^http://www\\.usgamer\\.net/", | |
| "pageElement":"//div[@class='headlines']/ul/li", | |
| "nextLink":"//div[@class='pager']//a[i/@class='icon-caret-right']", | |
| "wedata.net.id":77446 | |
| }, | |
| { | |
| "url":"^http://www\\.sinfest\\.net/", | |
| "pageElement":"//tbody[@class='style5']/tr[td/img]|//tr[.//tr[@class='cal-week' or @class='th']]|//p[@class='style1']/following-sibling::table[1]//tr", | |
| "nextLink":"//a[img/@src='../images/next.gif']|//tr[@class='th']/td[1]/a[not(@href='/archiveb.php?year=1999')]|//a[strong='Next']", | |
| "wedata.net.id":56908 | |
| }, | |
| { | |
| "url":"^https?://www\\.hkepc\\.com/", | |
| "pageElement":"id('items miniNews')/div[@class='item']|//table[@class='datatable']/tbody[starts-with(@id, 'normalthread')]", | |
| "nextLink":"//span[@class='active']/following-sibling::a[1]|//a[@class='next']", | |
| "wedata.net.id":32962 | |
| }, | |
| { | |
| "url":"^http://www\\.mangahere\\.co", | |
| "pageElement":"id('viewer')|//div[@class='manga_updates']/dl|//div[@class='directory_list']/ul/li", | |
| "nextLink":"//a[(@class='next_page' or @class='next') and not(@onclick)]|//a[@class='webkit_pageicon select']/following-sibling::a[1]|//strong[.='Next Chapter:']/following-sibling::a", | |
| "wedata.net.id":76345 | |
| }, | |
| { | |
| "url":"^http://japan\\.zdnet\\.com/", | |
| "pageElement":"//div[@class=\"article_body\" or @class=\"story_photoreport\"]", | |
| "nextLink":"//a[@id=\"script_pagination_next\" or @class=\"mediaNext noluke\"]", | |
| "wedata.net.id":76304 | |
| }, | |
| { | |
| "url":"^http://woman\\.mynavi\\.jp/", | |
| "pageElement":"//li[@class=\"new-articles-item\"]|//ol[@class=\"ranking-general-list\"]/li[./article[@class=\"article article-ranking\"]]|//div[@class=\"entry-pager\"]/preceding-sibling::*", | |
| "nextLink":"//div[@class=\"new-articles-button\"]/a|//link[@rel=\"next\"][not(//div[@class=\"new-articles-button\"])]", | |
| "wedata.net.id":77487 | |
| }, | |
| { | |
| "url":"^https://blog\\.riywo\\.com/", | |
| "pageElement":"//article", | |
| "nextLink":"//a[@class='older-posts']", | |
| "wedata.net.id":77074 | |
| }, | |
| { | |
| "url":"^http://javpub\\.(?:com|me)/", | |
| "pageElement":"//ul[contains(concat(\" \", normalize-space(@class), \" \"), \" main_loop \")]", | |
| "nextLink":"//li/a[.=\"Next\"]", | |
| "wedata.net.id":77490 | |
| }, | |
| { | |
| "url":"^http://kakaku\\.com/coupon/", | |
| "pageElement":"id(\"contentsArea\")/div[@class=\"listBox\"]", | |
| "nextLink":"//a[contains(text(), \"次へ\") and contains(@href, \"page=\") or child::img[@class=\"next01\"]]", | |
| "wedata.net.id":63572 | |
| }, | |
| { | |
| "url":"^http://m-pe\\.tv/u/m/novel/", | |
| "pageElement":"//hr[2]/following-sibling::node()[following-sibling::center[./script]]", | |
| "nextLink":"//a[contains(.,'次')]", | |
| "wedata.net.id":74432 | |
| }, | |
| { | |
| "url":"^http://www\\.s-manga\\.net/", | |
| "pageElement":"//div[contains(concat(\" \", @class, \" \"), \"BlogContents\")]/div[@class=\"inner\"]", | |
| "nextLink":"//a[@class=\"link_next\"]", | |
| "wedata.net.id":63638 | |
| }, | |
| { | |
| "url":"^http://www\\.fonts2u\\.com/", | |
| "pageElement":"id(\"container\")/div[@class=\"ppane\"]", | |
| "nextLink":"id(\"pager\")/a[contains(., \">\")][1]", | |
| "wedata.net.id":33204 | |
| }, | |
| { | |
| "url":"http://www.asofterworld.com/", | |
| "insertBefore":"//*[@id=\"previousnext\"]", | |
| "pageElement":"//*[@id=\"comicimg\"]/img", | |
| "nextLink":"//*[@id=\"next\"]/a", | |
| "wedata.net.id":80785 | |
| }, | |
| { | |
| "url":"^http://www\\.dena-ec\\.com/", | |
| "pageElement":"id('js-switchView-pannel')/ul/li", | |
| "nextLink":"//a[@class='stIconMd-keyboard-arrow-right']", | |
| "wedata.net.id":74493 | |
| }, | |
| { | |
| "url":"^http://let\\.hatelabo\\.jp/", | |
| "pageElement":"//div[@class=\"codelist\"]", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":32786 | |
| }, | |
| { | |
| "url":"^http://www\\.abcgames\\.sk/", | |
| "pageElement":"//div[@class='tab']/following-sibling::p[contains(., '>')][1]/following-sibling::table[@class='normal']/tbody/tr", | |
| "nextLink":"//div[@class='tab']/following-sibling::p/a[contains(., '>')]", | |
| "wedata.net.id":32772 | |
| }, | |
| { | |
| "url":"^http://search\\.cpan\\.org/", | |
| "pageElement":"//comment()[string()='results']/following-sibling::*[following::comment()[string()='end results']]|//div[@class=\"t4\"]/following-sibling::*[self::div[@class=\"path\"] or self::ul]", | |
| "nextLink":"//div[@class='pages']//td//a[last()]|//td[1]/a[starts-with(@href,'/recent?d=')]", | |
| "wedata.net.id":434 | |
| }, | |
| { | |
| "url":"^http://photo\\.xuite\\.net/", | |
| "pageElement":"//div[contains(concat(\" \", @class, \" \"), \" hot_list_block \")] | id(\"img_container\")/* | id(\"content\")/div[contains(concat(\" \", @class, \" \"), \" blogbody \")] | id(\"photo\")", | |
| "nextLink":"id(\"nav-next\") | id(\"promot_item\")/div[contains(concat(\" \", @class, \" \"), \" page \")]/text()[number()>0]/following-sibling::a[1]", | |
| "wedata.net.id":56054 | |
| }, | |
| { | |
| "url":"^http://www\\.facets\\.la\\/", | |
| "pageElement":"//div[@id='thumbs']", | |
| "nextLink":"//div[@id='search-box-next']/a", | |
| "wedata.net.id":80782 | |
| }, | |
| { | |
| "url":"^http://www\\.mp4ba\\.com\\/", | |
| "pageElement":"id('data_list')/tr[not(@id)]", | |
| "nextLink":"//a[contains(.,'下一页')]", | |
| "wedata.net.id":80777 | |
| }, | |
| { | |
| "url":"^http://www\\.x-berry\\.com/", | |
| "pageElement":"//div[@class='SL']/div[div/@class='p-head']", | |
| "nextLink":"//a[@class='nextpostslink']", | |
| "wedata.net.id":73844 | |
| }, | |
| { | |
| "url":"^https?://www\\.fakku\\.net/", | |
| "pageElement":"id(\"content\")/*", | |
| "nextLink":"id(\"pagination\")//a[@title=\"Next Page\"]", | |
| "wedata.net.id":33073 | |
| }, | |
| { | |
| "url":"^http://www\\.walmart\\.com/", | |
| "pageElement":"id('tile-container')/ul/li", | |
| "nextLink":"//a[@class='paginator-btn paginator-btn-next']", | |
| "wedata.net.id":32742 | |
| }, | |
| { | |
| "url":"^http://www\\.xconomy\\.com/", | |
| "pageElement":"//div[@class='storyNav']/preceding-sibling::*[not(span/@class='read_more' or @class='articleByline ' or contains(.,'(Page '))][preceding-sibling::p[2]]|//p[span/@class='read_more']/node()[not(self::span/@class='read_more')]|//p[contains(.,'(Page ')]/following-sibling::p[1]/node()|//table[@class='archives']/tbody/tr", | |
| "nextLink":"//span[@class='read_more']/a[last()]|//table[@class='archives']/tfoot//td[@align='right']/a[last()]", | |
| "wedata.net.id":32724 | |
| }, | |
| { | |
| "url":"^https://www\\.etsy\\.com/.+", | |
| "pageElement":"//ul[contains(@class,'listings')]/li", | |
| "nextLink":"id('pager-next')", | |
| "wedata.net.id":1264 | |
| }, | |
| { | |
| "url":"^http://hacklog\\.jp/awards/", | |
| "pageElement":"//article", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":30192 | |
| }, | |
| { | |
| "url":"^http://qonversations\\.net/", | |
| "pageElement":"id('texts_container')/*", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":74505 | |
| }, | |
| { | |
| "url":"^http://www\\.kitguru\\.net/", | |
| "pageElement":"//div[@class='post']/*[self::p/following-sibling::div/@class='ratingblock' or li]|//ul[@class='articles']/li", | |
| "nextLink":"//a[@rel='next']|//span[@class='contentjumpnumber']/following-sibling::a[1]", | |
| "wedata.net.id":77362 | |
| }, | |
| { | |
| "url":"^http://www\\.userbars\\.be/", | |
| "pageElement":"//div[@class='header title']/following-sibling::div/div[@class='ub_box' or @style]", | |
| "nextLink":"//span[@class='current']/following-sibling::a[1]", | |
| "wedata.net.id":32584 | |
| }, | |
| { | |
| "url":"^https?://www\\.vporno\\.tv/", | |
| "pageElement":"//div[@class=\"sectioncontent\"]//li", | |
| "nextLink":"id(\"pageNext\")/a", | |
| "wedata.net.id":55955 | |
| }, | |
| { | |
| "url":"^https?://ulocal\\..+\\.com/", | |
| "pageElement":"//div[@class='thumbBox clearfix']", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":77350 | |
| }, | |
| { | |
| "url":"^http://www\\.mmoinfo\\.net/", | |
| "pageElement":"id('main')/table", | |
| "nextLink":"//ol[@class=\"page\"]/li[last()]/a", | |
| "wedata.net.id":76434 | |
| }, | |
| { | |
| "url":"^http://www\\.wah\\.or\\.kr/", | |
| "pageElement":"id('in-box')//tbody/tr", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":77050 | |
| }, | |
| { | |
| "url":"^http://www\\.bigtits\\.com/", | |
| "pageElement":"id(\"content\")/div[contains(concat(\" \", @class, \" \"), \" box \")]/ul[contains(concat(\" \", @class, \" \"), \" videos \") or contains(concat(\" \", @class, \" \"), \" models \")]/li", | |
| "nextLink":"//p[contains(concat(\" \", @class, \" \"), \" pagination \")]/a[contains(concat(\" \", @class, \" \"), \" next \")]", | |
| "wedata.net.id":55951 | |
| }, | |
| { | |
| "url":"^http://onlinerecorded\\.com", | |
| "insertBefore":"//*[@id=\"footer\"]", | |
| "pageElement":"//*[@id=\"content\"]/div", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":77160 | |
| }, | |
| { | |
| "url":"^http://lunaticprophet\\.org", | |
| "pageElement":"//div[@class='entry']", | |
| "nextLink":"//span[@class='current']/following-sibling::a[1]", | |
| "wedata.net.id":43397 | |
| }, | |
| { | |
| "url":"http://[^/]+\\.mydealz\\.de/", | |
| "pageElement":"id('main')/ol/li", | |
| "nextLink":"//li[.//@class='pagi-link pagi-link--selected']/following-sibling::li[1]/a", | |
| "wedata.net.id":77025 | |
| }, | |
| { | |
| "url":"^http://www\\.naps-jp\\.com/", | |
| "pageElement":"//form[div/@class='prdctBoxDetail']", | |
| "nextLink":"//span[@class='on']/following-sibling::a[1]", | |
| "wedata.net.id":2091 | |
| }, | |
| { | |
| "url":"^http://blog\\.nhiroki\\.jp/", | |
| "pageElement":"//div[@class='post']/footer/preceding-sibling::*", | |
| "nextLink":"//a[@class='previous']", | |
| "wedata.net.id":77163 | |
| }, | |
| { | |
| "url":"^http://vod\\.ntv\\.co\\.jp/", | |
| "pageElement":"id('programlist')//li", | |
| "nextLink":"id('btn_next')", | |
| "wedata.net.id":63782 | |
| }, | |
| { | |
| "url":"^http://www\\.kyoto-u\\.com/", | |
| "pageElement":"//div[@class=\"art-Post\"][not(.//div[@class=\"navigation\"])]", | |
| "nextLink":"//div[@class=\"alignleft\"]/a", | |
| "wedata.net.id":29362 | |
| }, | |
| { | |
| "url":"^http://www\\.d-mania\\.com/", | |
| "pageElement":"//div[@class=\"rightpart\"]", | |
| "nextLink":"//a[text()='[次の20件]']", | |
| "wedata.net.id":76439 | |
| }, | |
| { | |
| "url":"^http://aow\\.triumph\\.net/", | |
| "pageElement":"//div[@class='entry-content news']|//ul[@class='bbp-topics' or @class='forums bbp-replies']/li[@class='bbp-body']/*[li or self::div]", | |
| "nextLink":"//a[../@class='nav-previous alignleft' or @class='next page-numbers']", | |
| "wedata.net.id":77337 | |
| }, | |
| { | |
| "url":"^http://forums\\.kuban\\.ru/", | |
| "pageElement":"id('posts')/*", | |
| "nextLink":"//div[@class='pagenav']/span/following-sibling::a", | |
| "wedata.net.id":53457 | |
| }, | |
| { | |
| "url":"^http://www\\.cbsnews\\.com/", | |
| "pageElement":"id('article-entry')", | |
| "nextLink":"//a[div[@class='next utilities-pagination-right']]", | |
| "wedata.net.id":30473 | |
| }, | |
| { | |
| "url":"^https?://www\\.tinhte\\.vn/", | |
| "pageElement":"//div[@class='section sectionMain recentNews']", | |
| "nextLink":"//link[@rel='next']", | |
| "wedata.net.id":75039 | |
| }, | |
| { | |
| "url":"^http://iine\\.hail2u\\.net/", | |
| "pageElement":"//article", | |
| "nextLink":"//a[@rel=\"prev\"]", | |
| "wedata.net.id":41475 | |
| }, | |
| { | |
| "url":"^http://www\\.hitfix\\.com/*", | |
| "pageElement":"//div[@class='article-body-copy']|//div[starts-with(@class,'column1')]//div[@class='post' or @class='featured-story-wrap' or (@class='listing' and .//@class='details') or @class='content-list nopad' or @class='recaps-box']|//table[starts-with(@class,'tboards')][last()]/*[not(tr/th/div/@class='small' or .//th='Started By')]", | |
| "nextLink":"//a[@class='next_page']", | |
| "wedata.net.id":74665 | |
| }, | |
| { | |
| "url":"^http://mindmaparchive\\.jp/", | |
| "pageElement":"id('in_contents_right_body')//div[@class='um10 width772']/*", | |
| "nextLink":"//span[@class='current_page']/following-sibling::a", | |
| "wedata.net.id":75025 | |
| }, | |
| { | |
| "url":"^http://r\\.gnavi\\.co\\.jp/", | |
| "pageElement":"//div[@class=\"search-result\"]/ul", | |
| "nextLink":"//li[@class=\"next\"]//a", | |
| "wedata.net.id":2482 | |
| }, | |
| { | |
| "url":"^http://race\\.sanspo\\.com/", | |
| "pageElement":"id('popin_content_main')//li", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":72738 | |
| }, | |
| { | |
| "url":"^http://www\\.jognote\\.com/", | |
| "pageElement":"//div[@class=\"boxBody\"]/div[@class=\"thickline_box\"]", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":30535 | |
| }, | |
| { | |
| "url":"^https?://blog\\.wenn\\.com/", | |
| "pageElement":"id('top-story-container')//*[span/@class='wp-pagenavi' or self::strong/div]/preceding-sibling::div", | |
| "nextLink":"//span[@class='current']/following-sibling::a[1]", | |
| "wedata.net.id":74682 | |
| }, | |
| { | |
| "url":"^http://www\\.garitto\\.com/", | |
| "pageElement":"//div[@class='list']/*", | |
| "nextLink":"//div[@class='pager']/strong[1]/following-sibling::a", | |
| "wedata.net.id":64779 | |
| }, | |
| { | |
| "url":"^http://www\\.appbank\\.net/", | |
| "pageElement":"//ul[@class='entry-list']/li", | |
| "nextLink":"//a[@class='old']", | |
| "wedata.net.id":30629 | |
| }, | |
| { | |
| "url":"^http://www\\.letsjav\\.com/", | |
| "pageElement":"//div[@class=\"row post-col\"]", | |
| "nextLink":"//a[(span/text()=\"›\")]", | |
| "wedata.net.id":80964 | |
| }, | |
| { | |
| "url":"^http://tamotopi\\.com/(.+)/", | |
| "pageElement":"id(\"the-content\")/p[./span[@style]/b][1]/preceding-sibling::*|//*[@class=\"entry-title\" or @class=\"post-meta\"]", | |
| "nextLink":"id('prev')", | |
| "wedata.net.id":77531 | |
| }, | |
| { | |
| "url":"^https?://x\\.epidemz\\.com/", | |
| "pageElement":"//div[@id='dle-content']", | |
| "nextLink":"//*[@id=\"dle-content\"]/div/a[text()=\"►\"]", | |
| "wedata.net.id":80826 | |
| }, | |
| { | |
| "url":"^http://www\\.engineer\\.jp/", | |
| "pageElement":"//div[@class=\"pd_ichiran\"]", | |
| "nextLink":"//a[contains(text(), \"次へ\")]", | |
| "wedata.net.id":64775 | |
| }, | |
| { | |
| "url":"^http://www.israbox\\.com/.*", | |
| "pageElement":"//div[@class='story']", | |
| "nextLink":"//a[contains(.,'→')]", | |
| "wedata.net.id":74685 | |
| }, | |
| { | |
| "url":"http://www.soundhouse.co.jp/", | |
| "pageElement":"//ul[@class='article']/li", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":76981 | |
| }, | |
| { | |
| "url":"^http://www\\.dogdrip\\.net/", | |
| "pageElement":"//table[contains(concat(\" \", normalize-space(@class), \" \"), \" boardList \")]/tbody/tr", | |
| "nextLink":"//div[contains(concat(\" \", normalize-space(@class), \" \"), \" pagination \")]/strong/following-sibling::a", | |
| "wedata.net.id":77541 | |
| }, | |
| { | |
| "url":"^http://blog\\.waybig\\.com/", | |
| "pageElement":"id(\"maintable\")//div[@class=\"post\"]", | |
| "nextLink":"id(\"maintable\")//a[contains(concat(\" \", @class, \" \"), \" next \")]", | |
| "wedata.net.id":27458 | |
| }, | |
| { | |
| "url":"^http://bara\\.blue12\\.net/", | |
| "pageElement":"id(m2')", | |
| "nextLink":"id('dt3')/a[.='次へ']", | |
| "wedata.net.id":29245 | |
| }, | |
| { | |
| "url":"^http://posren\\.com/search/", | |
| "pageElement":"//section[@class='imageListWrapper']/*", | |
| "nextLink":"//a[@class='arrow'][.='> ']", | |
| "wedata.net.id":30694 | |
| }, | |
| { | |
| "url":"^http://www\\.comicfan\\.jp/", | |
| "pageElement":"//tr[td/@class='name']", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":35271 | |
| }, | |
| { | |
| "url":"^http://www\\.hardocp\\.com/", | |
| "pageElement":"id('hardnews')/*[not(self::h2)][not(//div/@id='archivelist')]|id('archivelist')/div[@class='day']|id('reviews')/ol/li", | |
| "nextLink":"//a[@title='Previous News']|//li[@class='nextpg']/a", | |
| "wedata.net.id":77861 | |
| }, | |
| { | |
| "url":"^http://www\\.youjizz\\.com/", | |
| "pageElement":"id(\"pagination\")/preceding-sibling::*", | |
| "nextLink":"id(\"pagination\")/span/following-sibling::a[1]", | |
| "wedata.net.id":32497 | |
| }, | |
| { | |
| "url":"^https://www\\.senukai\\.lt/", | |
| "pageElement":"//div[@class='product-item']", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":76974 | |
| }, | |
| { | |
| "url":"^http://www\\.theroot\\.com/", | |
| "pageElement":"//div[@class='page-container']/*", | |
| "nextLink":"//a[@class='next active']", | |
| "wedata.net.id":35364 | |
| }, | |
| { | |
| "url":"^http://www\\.pornhub\\.com/", | |
| "pageElement":"//li[contains(concat(' ', @class, ' '), ' videoblock ')] | //ul[contains(concat(\" \", @class, \" \"), \" box-nf-photo \")] rnrnrnrnrn", | |
| "nextLink":"//li[contains(concat(' ', @class, ' '), \" page_next \")]/a", | |
| "wedata.net.id":32485 | |
| }, | |
| { | |
| "url":"^http://www\\.2nn\\.jp/word/", | |
| "pageElement":"//section[@class='newsplus']/article/ol/li", | |
| "nextLink":"id('pager')/a[contains(.,'>>')]", | |
| "wedata.net.id":29208 | |
| }, | |
| { | |
| "url":"^http://forums\\.xbox\\.com/", | |
| "pageElement":"//li[@class='content-item']|//table[@class='table-list']/tbody/tr", | |
| "nextLink":"//a[@class='page selected']/following-sibling::a[1]", | |
| "wedata.net.id":27490 | |
| }, | |
| { | |
| "url":"^http://.+\\.indiewire\\.com", | |
| "pageElement":"//article[starts-with(@id,'post-')]|//div[@class='hide-tab tab-content-1 selected']/ul/li|//div[@class='page-links']/preceding-sibling::p[1]/preceding-sibling::*", | |
| "nextLink":"//div[@class='hidden-mobile']/div[@class='pagination simple-pagination'][count(./a)>1 or contains(a/@href,'page/2/')]/a[last()]|//a[@class='next page-numbers']|//div[@class='page-links']/text()[string-length(normalize-space()) > 0][last()]/following-sibling::a[1]", | |
| "wedata.net.id":74722 | |
| }, | |
| { | |
| "url":"^http://[^/.]+\\.jugem\\.jp/", | |
| "pageElement":"//*[@class='contents' or contains(' main center content ',concat(' ',@id,' ')) or local-name()='td']//*[contains(concat(' ',@class,' '),' entry ') or contains(concat(' ',@class,' '),' section ') or contains(' comment relatedEntry trackback ',concat(' ',@id,' ')) or contains(' comment relatedEntry trackback trackack ',concat(' ',@class,' '))]|id('contents')[h2 and div]/ul[@class='navi']/preceding-sibling::node()|id('main')/dl", | |
| "nextLink":"id('main')/div[contains(concat(' ',@class,' '),' page_navi ')]/a[last()]|id('main center')//div[@class='entry_navi']/a[contains(@href,'/?eid=') or not(.='>>')]|//div[@class='entry_navi']/a[contains(@href,'/?eid=')]|//div[@class='entry_navi']/span/a[contains(.,'prev')]|id(\"navi\")/div[@class='entry_navi']/a[last()]|id('pager')/span[contains(concat(' ', @class, ' '), ' pager_next ')]/a|id('entryNavi')/a|id('pager')/span[@class='current']/following-sibling::span[1]/a|//*[contains(' next page pagingLink ',concat(' ',@class,' '))]//a[.='>>']|id('main')//ul/li[@class='prev']/a[not(.='<<')]|id('contents')/ul/li/a[.='>>']|//dd[@class='pagenavi']/span/a[contains(.,'next')]|//div[@class='paging']/a[contains(.,'>')]|id('content')//div[@class='pagingLink']/ul/li/a[@title]|//td[@align='right']/a[contains(.,'old')]", | |
| "wedata.net.id":40577 | |
| }, | |
| { | |
| "url":"^https://torrentfreak\\.com/", | |
| "pageElement":"//article", | |
| "nextLink":"//div[@class='posts-nav-next']/a", | |
| "wedata.net.id":79953 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?dx\\.com/", | |
| "pageElement":"(//ul[@class='productList subList']|id('s_product_list'))/li", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":29190 | |
| }, | |
| { | |
| "url":"^http://memegenerator\\.net/", | |
| "pageElement":"//ul[starts-with(@class,'horizontal gallery')]/li", | |
| "nextLink":"//li[@class='active']/following-sibling::li[1]/a", | |
| "wedata.net.id":55794 | |
| }, | |
| { | |
| "url":"^http://.+\\.suntimes\\.com/", | |
| "pageElement":"//article[starts-with(@class,'post')][not(//hr)]|//div[hr][starts-with(article/@class,'post')]", | |
| "nextLink":"//a[../@class='nav-next' or @rel='prev']|//div[@class='pagination']/span[@class='current']/following-sibling::a[1]|//ol[@class='nav pagination']/li[contains(span/@class,'current')]/following-sibling::li[1]/a", | |
| "wedata.net.id":76485 | |
| }, | |
| { | |
| "url":"^http://www\\.thewrap\\.com/", | |
| "pageElement":"id('main')//ul/li[.//img]", | |
| "nextLink":"//a[@class='p-next page-numbers']", | |
| "wedata.net.id":74732 | |
| }, | |
| { | |
| "url":"^https?://www\\.infoq\\.com/", | |
| "pageElement":"id('content')/*[contains(@class,'news_type') or contains(@class,'ebook_list') or @class='clear' or self::ul]", | |
| "nextLink":"//a[@class='older-articles']", | |
| "wedata.net.id":77612 | |
| }, | |
| { | |
| "url":"^http://www\\.hmv\\.co\\.jp/", | |
| "pageElement":"id(\"mypageEditor_wishlist\")/div[@class=\"goods\"]/ul|//ul[@class='resultList']/li", | |
| "nextLink":"//a[@class='trigger next']", | |
| "wedata.net.id":484 | |
| }, | |
| { | |
| "url":"^http://.*?\\.solidot\\.org/", | |
| "pageElement":"id('center')/div[@class='block_m']", | |
| "nextLink":"//div[@class='page']/a[last()]", | |
| "wedata.net.id":74751 | |
| }, | |
| { | |
| "url":"^http://www\\.mangaice\\.com", | |
| "pageElement":"//a[img/@class='manga-page']", | |
| "nextLink":"//ul[@class='nav_pag']//a[.='Next']", | |
| "wedata.net.id":77668 | |
| }, | |
| { | |
| "url":"^http://www\\.france\\.jp/.+", | |
| "pageElement":"//div[@class='mold']/div[starts-with(@class,'enclose')]", | |
| "nextLink":"//li[@class='rli']/span/following-sibling::a[1]", | |
| "wedata.net.id":29132 | |
| }, | |
| { | |
| "url":"^https://dev\\.mozilla\\.jp/", | |
| "pageElement":"id(\"content\")/*", | |
| "nextLink":"//link[@rel=\"prev\"]|//div[@class=\"navigation\"]//span[@class=\"current\"]/following-sibling::a", | |
| "wedata.net.id":61065 | |
| }, | |
| { | |
| "url":"^http://www\\.lua\\.org/pil/", | |
| "pageElement":"//hr[1]/following-sibling::node()[following-sibling::hr]", | |
| "nextLink":"//img[@alt=\"Next\"]/..", | |
| "wedata.net.id":1654 | |
| }, | |
| { | |
| "url":"^http://j-nbooks\\.jp/comic/", | |
| "pageElement":"//div[@class='imgLoad-box']", | |
| "nextLink":"//div[@class='comicOriginal']/following-sibling::div[@class='backNumber_area']/div[@class='num_comicOriginal']/a[@class='radius current new']/following-sibling::a", | |
| "wedata.net.id":76917 | |
| }, | |
| { | |
| "url":"^http://www\\.pcworld\\.com/", | |
| "pageElement":"id('home-main-primary')/div", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":29101 | |
| }, | |
| { | |
| "url":"^http://www\\.moongift\\.jp/", | |
| "pageElement":"//div[@class=\"mg_list cf\"]", | |
| "nextLink":"//span[@class=\"next\"]/a", | |
| "wedata.net.id":503 | |
| }, | |
| { | |
| "url":"^http://www\\.freepik\\.com/", | |
| "pageElement":"id('images slideSheet')", | |
| "nextLink":"//li[@class='current']/following-sibling::li/a", | |
| "wedata.net.id":76907 | |
| }, | |
| { | |
| "url":"^http://(www\\.)?t66y\\.com/", | |
| "pageElement":"id('ajaxtable')//tr[@class='tr2']/following-sibling::tr", | |
| "nextLink":"//div[@class='pages']/a[u]/following-sibling::a[1]", | |
| "wedata.net.id":64299 | |
| }, | |
| { | |
| "url":"^http://www\\.dugg\\.com.au/", | |
| "pageElement":"//div[@class='category-products']/ul/li", | |
| "nextLink":"//a[@class='next ic ic-right']", | |
| "wedata.net.id":76502 | |
| }, | |
| { | |
| "url":"^https://www\\.anikore\\.jp/", | |
| "pageElement":"//div[starts-with(@class,'comp_rank_box ') or @class='anime_title_eval' or @class='animeSearchResultBody' or starts-with(@class,'rankingBox cf ')]", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":76504 | |
| }, | |
| { | |
| "url":"^https?://www\\.pixiv\\.net/", | |
| "pageElement":"//*[not(@class='popular-introduction' or (contains(@class,'_unit') and //li/@class='bookmark-item'))]/ul[contains(@class,'_image-items') or contains(@class,'novel-items') or contains(@class,'tag-list inline-') or @class='bookmark-items' or @class='type_entrylist' or @class='member-items' or @class='thu' or @class='user-recommendation-items' or parent::node()[@class='members' or contains(@class,'search_a2_result')]]/li[not(//div/@class='_unit _work-detail-unit')]|//div[@class='event-information' or starts-with(@class,'stacc_status ') or contains(@class,'work-detail-unit') or ../@class='spotlight-items']", | |
| "nextLink":"//a[@rel='next' or contains(concat(' ',@class,' '),' next ')]|(//nav[@class='column-menu']/ul/li[@class='after']|//span[@class='stacc_more_link']|//div[@class='spotlight-items']/p[@class='more'])/a", | |
| "wedata.net.id":669 | |
| }, | |
| { | |
| "url":"^http://blog\\.getchu\\.com/", | |
| "pageElement":"id(\"blog\")/div[@class=\"fullbody\"]", | |
| "nextLink":"//a[@rel=\"next\"]|id(\"blog\")/div[@class=\"nextpage\"]/a[contains(text(),\"次\")]", | |
| "wedata.net.id":61221 | |
| }, | |
| { | |
| "url":"^http://www\\.web2null\\.de/", | |
| "pageElement":"//div[@class='entry']", | |
| "nextLink":"//span[@class='current']/following-sibling::a[1]", | |
| "wedata.net.id":31186 | |
| }, | |
| { | |
| "url":"^http://blog\\.inasoft\\.org", | |
| "pageElement":"id(\"content\")/div[@class=\"blog\"]|id(\"comments\")[.//div[@class=\"comments-body\"]/div[@class=\"text\"]]", | |
| "nextLink":"id(\"content\")/div[@class=\"navi\"][1]/a[1][not(contains(@href,\"index-\"))][not(@href=\"http://blog.inasoft.org/\")][count(id(\"content\")/div[@class=\"navi\"])<3 or not(//div[@class=\"navi\"][last()]/text()[number(translate(., \"- \", \"\")) > 0]/following-sibling::a)]|id(\"content\")/div[@class=\"navi\"][last()]/text()[number(translate(., \"- \", \"\")) > 0]/following-sibling::a[1][count(id(\"content\")/div[@class=\"navi\"])=3]|id(\"content\")/div[@class=\"navi\"][1]/a[last()][contains(@href,\"index-\")]", | |
| "wedata.net.id":74808 | |
| }, | |
| { | |
| "url":"^http://3d\\.nicovideo\\.jp/", | |
| "pageElement":"//div[@class='work-box-container']/*", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":74810 | |
| }, | |
| { | |
| "url":"^http://i-bbs\\.sijex\\.net/", | |
| "pageElement":"//form[@action=\"/pc/delete.jsp\"]", | |
| "nextLink":"//table//td[@class=\"normal\"]//b[text()=\">\"]/parent::a", | |
| "wedata.net.id":2204 | |
| }, | |
| { | |
| "url":"^http://www\\.sokmil\\.com/.", | |
| "pageElement":"//div[@class='display-img product-list']", | |
| "nextLink":"//li[@class=\"pagination-item next\"]/a", | |
| "wedata.net.id":37894 | |
| }, | |
| { | |
| "url":"^http://garari\\.jugem\\.jp/", | |
| "pageElement":"//div[@class=\"entry\"]", | |
| "nextLink":"//div[@class=\"paging\"]/a[contains(text(), \"old\")]", | |
| "wedata.net.id":1873 | |
| }, | |
| { | |
| "url":"^http://webheibon\\.jp/oboe/", | |
| "pageElement":"id(\"contents\")|id(\"header\")/h2", | |
| "nextLink":"id(\"bnBox\")//li[contains(text(),substring-before(substring-after(id(\"header\")/h2/text(),\"第\"),\"回\"))]/following-sibling::li[1]/a", | |
| "wedata.net.id":77211 | |
| }, | |
| { | |
| "url":"^http://[^.]+\\.2chan\\.net/", | |
| "pageElement":"//div[@class=\"delform\"]/preceding-sibling::hr[1]/preceding-sibling::*", | |
| "nextLink":"//tr[td//form/input[@accesskey=\"x\"]]/td/b/following-sibling::a", | |
| "wedata.net.id":2675 | |
| }, | |
| { | |
| "url":"^http://www\\.cracked\\.com/", | |
| "pageElement":"//section[@class=\"body\"]/section[p]", | |
| "nextLink":"//nav[@class='PaginationContent']//a[contains(@class,'next')]", | |
| "wedata.net.id":31347 | |
| }, | |
| { | |
| "url":"^http://(.+)?gamersky\\.com/", | |
| "pageElement":"(id('gspaging')|//div[contains(@class,'Mid') and contains(@class,'L') and contains(@class,'con')])/p", | |
| "nextLink":"//div[@class='page_css']/b/following-sibling::a[1]", | |
| "wedata.net.id":76506 | |
| }, | |
| { | |
| "url":"^http://www\\.b-otaku\\.com/", | |
| "pageElement":"//div[@align=\"center\"]//table[.//span[contains(@class,\"TopTitle\")] or .//td[@class=\"DateDiary\"]]|//center/table|//frame[@name=\"contents\"]", | |
| "nextLink":"//a[contains(@class,\"LinkNext\") or @target=\"_self\"]|//span[@class=\"LinkNext\"][last()]/a", | |
| "wedata.net.id":76652 | |
| }, | |
| { | |
| "url":"^http://www\\.apktops\\.com/", | |
| "pageElement":"//article[@class='postlist']/section", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":61321 | |
| }, | |
| { | |
| "url":"^http://(.+\\.)?hexus\\.net/", | |
| "pageElement":"//aricle|id('articlecontent')", | |
| "nextLink":"//a[@class='next_page']", | |
| "wedata.net.id":2847 | |
| }, | |
| { | |
| "url":"^http://.*\\.247sports\\.com", | |
| "pageElement":"//li[ul/@class='boarditm_lst clearfix' or starts-with(@class,'user_')]", | |
| "nextLink":"//a[@class='pagn_next pagn_link']", | |
| "wedata.net.id":76825 | |
| }, | |
| { | |
| "url":"^http://www\\.socwall\\.com/", | |
| "pageElement":"//ul[@class='wallpaperList']/li", | |
| "nextLink":"//li[@class='nextPage']/a", | |
| "wedata.net.id":537 | |
| }, | |
| { | |
| "url":"^http://www\\.j-n\\.co\\.jp/", | |
| "pageElement":"id('browsingList searchResultList')/*", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":64686 | |
| }, | |
| { | |
| "url":"^https?://www\\.jalan\\.net/", | |
| "pageElement":"//div[@class=\"result\"]", | |
| "nextLink":"//a[@class=\"paging\" and contains(text(), \"次へ\")]", | |
| "wedata.net.id":64680 | |
| }, | |
| { | |
| "url":"^http://blog\\.syosetu\\.com", | |
| "pageElement":"//div[@class='pageswitch' or @class='btnspace'][1]/preceding-sibling::*", | |
| "nextLink":"(//link[@rel='prev']|//ul[@class='link']/li[last()]/a)[not(//a/span/@class='npsb_nextlink')]|//a[span/@class='npsb_nextlink']", | |
| "wedata.net.id":55131 | |
| }, | |
| { | |
| "url":"http://www\\.techspot\\.com/", | |
| "pageElement":"id('feature')", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":76805 | |
| }, | |
| { | |
| "url":"^http://(?:www\\.)?nya\\.sh/", | |
| "pageElement":"//div[@class='q']", | |
| "nextLink":"//div[@class='pages']/b/following-sibling::a[1]", | |
| "wedata.net.id":61447 | |
| }, | |
| { | |
| "url":"^http://pornopovidky\\.info/", | |
| "pageElement":"id('post-entry')", | |
| "nextLink":"id('post-navigator')//*[@class='current']/following-sibling::a[1]", | |
| "wedata.net.id":62050 | |
| }, | |
| { | |
| "url":"^http://kinonoki\\.com/book/", | |
| "pageElement":"//div[@class=\"sctionNavHeader\"]/following-sibling::*[./following-sibling::div[@class=\"sctionNavFooter\"]]", | |
| "nextLink":"//a[@class=\"numbers current\"]/following-sibling::a[1]", | |
| "wedata.net.id":80914 | |
| }, | |
| { | |
| "url":"^http://www\\.newsday\\.com/", | |
| "pageElement":"//ul[@class='list']/li", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":2830 | |
| }, | |
| { | |
| "url":"^http://buzzingbubble\\.com/", | |
| "pageElement":"//div[@class='my_cpt_gallery_paged']/*", | |
| "nextLink":"//a[@class='next page-numbers']", | |
| "wedata.net.id":80691 | |
| }, | |
| { | |
| "url":"^http://www\\.ochrance\\.cz/", | |
| "pageElement":"//div[@class='aktualita_polozka']", | |
| "nextLink":"//span[@class='active']/following-sibling::span[1]/a", | |
| "wedata.net.id":62046 | |
| }, | |
| { | |
| "url":"^http://zapanet\\.info/blog/", | |
| "insertBefore":"//div[@class=\"in\"]/div[@class=\"ido\"]", | |
| "pageElement":"//div[@class=\"in\"]/*[@class=\"btitle\" or @class=\"bitem\" or @class=\"more\" or @class=\"iitem\"]", | |
| "nextLink":"//div[@class=\"in\"]/div[@class=\"ido\"]/span[@class=\"next\"]/a", | |
| "wedata.net.id":600 | |
| }, | |
| { | |
| "url":"^http://tabesugi\\.net/memo/", | |
| "pageElement":"//div[form]/following-sibling::node()[following-sibling::p/@class='nav']", | |
| "nextLink":"//p[@class='nav']/a[not(contains(@href,'index'))][not(contains(@href,'#head'))]", | |
| "wedata.net.id":31712 | |
| }, | |
| { | |
| "url":"^http://.*\\.keenspot\\.com/", | |
| "pageElement":"//img[@class='ksc']|id('cg_img')", | |
| "nextLink":"//a[@rel='next']|id('cg_next')|id('comicarea')/a", | |
| "wedata.net.id":76767 | |
| }, | |
| { | |
| "url":"^http://www\\.cnn\\.co\\.jp/", | |
| "pageElement":"id('leaf-body')|//ul[@class='video-list']/li", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":55227 | |
| }, | |
| { | |
| "url":"^http://www\\.infocart\\.jp/", | |
| "pageElement":"//tr[td/@class='list_box']", | |
| "nextLink":"//a[span/@class='current']/following-sibling::a[1]", | |
| "wedata.net.id":2719 | |
| }, | |
| { | |
| "url":"^https://akiba-souken\\.com/", | |
| "pageElement":"//div[@class=\"listBox\"]", | |
| "nextLink":"//li[@class=\"next\"]/a", | |
| "wedata.net.id":31744 | |
| }, | |
| { | |
| "url":"^http://3d\\.skr\\.jp/[23]d/", | |
| "pageElement":"//center[form[contains(concat(@action,\" \"),\"d.php \")]]/following-sibling::form/node()[following-sibling::table[@align=\"left\"]]", | |
| "nextLink":"//table[@align=\"left\"]//td/b/following-sibling::a", | |
| "wedata.net.id":62015 | |
| }, | |
| { | |
| "url":"^http://blog\\.volume2\\.jp/", | |
| "pageElement":"id(\"entries\")/article", | |
| "nextLink":"//li[@class=\"nextBtn\"]/a", | |
| "wedata.net.id":28290 | |
| }, | |
| { | |
| "url":"^https://wiki\\.gnome\\.org/", | |
| "pageElement":"//div[@class=\"searchresults\"]//li", | |
| "nextLink":"//table[@class=\"searchpages\"]//td[last()]/a", | |
| "wedata.net.id":80574 | |
| }, | |
| { | |
| "url":"^http://www\\.iinamae\\.net/", | |
| "pageElement":"//div[@class='frame2']", | |
| "nextLink":"//a[contains(.,'>')]", | |
| "wedata.net.id":74910 | |
| }, | |
| { | |
| "url":"^http://www\\.templated\\.co", | |
| "pageElement":"//article", | |
| "nextLink":"//li[@class='page current']/following-sibling::li[1]/a", | |
| "wedata.net.id":28272 | |
| }, | |
| { | |
| "url":"^http://eow\\.alc\\.co\\.jp/", | |
| "pageElement":"id('resultsList')/ul/li", | |
| "nextLink":"//a[img/@alt='次へ']", | |
| "wedata.net.id":61669 | |
| }, | |
| { | |
| "url":"^http://soft\\.oszone\\.net/", | |
| "pageElement":"//div[@id=\"pagenav\"]/following-sibling::*[following-sibling::div[@id=\"pagenav\"]]", | |
| "nextLink":"//span[@class='listact']/following-sibling::a[1]", | |
| "wedata.net.id":38763 | |
| }, | |
| { | |
| "url":"^http://pr\\.mixi\\.co\\.jp/", | |
| "pageElement":"id(\"main\")/div[@class=\"news\" or @class=\"entry\"]", | |
| "nextLink":"id(\"main\")/div/ul/li/a[@class=\"link_next\"]|id(\"main\")/div/div/table//td[@align=\"left\"]/a", | |
| "wedata.net.id":55271 | |
| }, | |
| { | |
| "url":"^https://share\\.dmhy\\.org/", | |
| "pageElement":"id(\"container\")", | |
| "nextLink":"//div[contains(concat(\" \", @class, \" \"), \" nav_title \")]/a[.=\"下一頁\"]", | |
| "wedata.net.id":55382 | |
| }, | |
| { | |
| "url":"^http://www\\.liveleak\\.com", | |
| "pageElement":"//ul[@class='item_list' or @class='item_grid']/li", | |
| "nextLink":"//a[img/@title='Go to next page']", | |
| "wedata.net.id":80677 | |
| }, | |
| { | |
| "url":"^http://www.drjays.com/shop/", | |
| "pageElement":"id('products')/*", | |
| "nextLink":"//a[@class='pagination_top pagination_next']", | |
| "wedata.net.id":38919 | |
| }, | |
| { | |
| "url":"^https://vivaldi\\.net/forum", | |
| "pageElement":"//div[@class='kblock']/div[@class='kcontainer']/div[@class='kbody']", | |
| "nextLink":"//ul[@class='kpagination']/li[span]/following-sibling::li[1]/a", | |
| "wedata.net.id":77246 | |
| }, | |
| { | |
| "url":"^https://www\\.kakooyo\\.jp/", | |
| "pageElement":"//div[@class='area_thumb']/*", | |
| "nextLink":"//a[@title='次のページ']", | |
| "wedata.net.id":76712 | |
| }, | |
| { | |
| "url":"^http://m-pe\\.tv/u/m/album/", | |
| "pageElement":"//a[contains(text(),\"戻る\")]/preceding-sibling::node()", | |
| "nextLink":"//a[@accesskey=\"#\"]", | |
| "wedata.net.id":33092 | |
| }, | |
| { | |
| "url":"^http://www\\.ryuzee\\.com/", | |
| "pageElement":"//div[@class='row']/div[div/@class='blog-desc']", | |
| "nextLink":"//a[@class='btn-theme btn'][.='次のページ']", | |
| "wedata.net.id":27987 | |
| }, | |
| { | |
| "url":"^http://www\\.verycd\\.com/", | |
| "pageElement":"//div[.//ul/@class='page' or @class='pnav']/preceding-sibling::ul[1]/li[.//img][not(@id='searchBar')]", | |
| "nextLink":"//a[@rel='next' or @class='next']", | |
| "wedata.net.id":32005 | |
| }, | |
| { | |
| "url":"^http://dresdencodak\\.com/", | |
| "pageElement":"id(\"comic\")/a", | |
| "nextLink":"//a[img[@src=\"http://dresdencodak.com/m_next2.png\"]]", | |
| "wedata.net.id":77640 | |
| }, | |
| { | |
| "url":"^http://www\\.nikkei\\.com/", | |
| "pageElement":"//div[@class=\"cmn-article_list_style1\"]//li|//ul[@class=\"cmn-article_list\"]/li[not(id(\"JSID_pageNation\"))]|//div[@class=\"cmn-article_text JSID_key_fonttxt\"]|//div[@class=\"cmn-article_text a-cf JSID_key_fonttxt\"]", | |
| "nextLink":"//li[@class=\"cmnc-next\"]/a|id(\"JSID_pageNation\")//li[last()]/a", | |
| "wedata.net.id":31897 | |
| }, | |
| { | |
| "url":"^http://www\\.spiegel\\.de/", | |
| "pageElement":"id(\"spArticleBody\")", | |
| "nextLink":"//a[text()=\"Next\"]", | |
| "wedata.net.id":2735 | |
| }, | |
| { | |
| "url":"^https?://middle-edge\\.jp/", | |
| "pageElement":"//div[contains(@class,'article-item')]", | |
| "nextLink":"//link[@rel=\"next\"]", | |
| "wedata.net.id":80567 | |
| }, | |
| { | |
| "url":"^http://www\\.rlslog\\.net/", | |
| "pageElement":"//div[@class='entry']", | |
| "nextLink":"//a[.='Next Page »']", | |
| "wedata.net.id":76785 | |
| }, | |
| { | |
| "url":"^http://www\\.free18\\.net/", | |
| "pageElement":"//table[.//div[contains(concat(' ', @class, ' '), ' thumb-border ')] and not(.//table[.//div[contains(concat(' ', @class, ' '), ' thumb-border ')]])]", | |
| "nextLink":"//div[contains(concat(' ', @class, ' '), ' pages ')]/span[contains(concat(' ', @class, ' '), ' ThisPage ')]/following-sibling::a[1]", | |
| "wedata.net.id":62049 | |
| }, | |
| { | |
| "url":"^http://.+\\.tbs\\.co\\.jp/", | |
| "pageElement":"//div[@class='listitem' or @class='entry']", | |
| "nextLink":"//div[@class='pagenation']//li[span]/following-sibling::li[1]/a", | |
| "wedata.net.id":80700 | |
| }, | |
| { | |
| "url":"^http://www\\.dafont\\.com/", | |
| "pageElement":"//div[@class=\"titlebar\"][1]/following-sibling::div[./form[@name=\"nb\"]][1]/following-sibling::*[./following-sibling::div[@class=\"titlebar\"]]", | |
| "nextLink":"//span[@class=\"select\"]/following-sibling::a[1]", | |
| "wedata.net.id":1868 | |
| }, | |
| { | |
| "url":"^http://chromaofwall\\.com/", | |
| "pageElement":"id(\"contentleft\")/*[not(self::div[contains(concat(\" \", @class, \" \"), \" wp-pagenavi \")])]", | |
| "nextLink":"//span[contains(concat(\" \", @class, \" \"), \" current \")]/following-sibling::a[1]|//link[@rel=\"prev\"]", | |
| "wedata.net.id":54747 | |
| }, | |
| { | |
| "url":"^https://store\\.line\\.me/", | |
| "pageElement":"//div[@class='LyMain']//section/div/ul/li", | |
| "nextLink":"//a[contains(@class,'Next')]", | |
| "wedata.net.id":74824 | |
| }, | |
| { | |
| "url":"^http://www\\.sanspo\\.com/", | |
| "pageElement":"id(\"Contents\")/descendant::*[self::div[contains(concat(\" \", @class, \" \"), \" PhotoDetail \")] or self::ul[contains(concat(\" \", @class, \" \"), \" PhotoList \")]]|//ul[@class=\"NewsList\"][not(//div[@class=\"NewsDetail\"])]|//div[@class=\"NewsDetail\"]/p[last()][./a]/preceding-sibling::*|//div[@class=\"NewsDetail\"][./p[last()][not(./a)]]", | |
| "nextLink":"//a[contains(img/@src, \"next.gif\")]", | |
| "wedata.net.id":1669 | |
| }, | |
| { | |
| "url":"^http://lolfbmoments\\.com/", | |
| "pageElement":"//div[@class='post']", | |
| "nextLink":"//li[@class='nav-prev even']/a", | |
| "wedata.net.id":32077 | |
| }, | |
| { | |
| "url":"^http://rmz\\.cr/feature/.*", | |
| "pageElement":"//div[@class=\"list_items\"]//li", | |
| "nextLink":"//span[@class=\"current\"]/following-sibling::a[1]", | |
| "wedata.net.id":80929 | |
| }, | |
| { | |
| "url":"^http://ebook\\.bike/search", | |
| "pageElement":"//div[@class='bookitem']", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":63449 | |
| }, | |
| { | |
| "url":"^http://www\\.4gamer\\.net/", | |
| "pageElement":"//div[@class=\"maintxt\"]", | |
| "nextLink":"//div[@class=\"paging\"]/*[last()][self::a]", | |
| "wedata.net.id":27671 | |
| }, | |
| { | |
| "url":"^http://www\\.spiegel\\.de/", | |
| "pageElement":"//div[@class='column-wide']/div[@class='article-section clearfix']/node() | //div[@class=\"biga-entries\"]/div[@class=\"biga-image\"] | //div[@class=\"biga-entries\"]/p | //div[@class='column-wide clearfix']/*", | |
| "nextLink":"//a[@class='link-right']", | |
| "wedata.net.id":31379 | |
| }, | |
| { | |
| "url":"^http://www\\.moez-m\\.com/", | |
| "pageElement":"//div[contains(concat(\" \", @class, \" \"), \" entry-box \")]", | |
| "nextLink":"//a[contains(concat(\" \", @class, \" \"), \" link_next \")]", | |
| "wedata.net.id":61309 | |
| }, | |
| { | |
| "url":"^http://bbs\\.szhome\\.com/", | |
| "pageElement":"//div[@class='mainList bg-gryafa fix']/dl|//div[@class='post-wrap fix item item-reply']", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":64383 | |
| }, | |
| { | |
| "url":"^http://soso\\.nipic\\.com/", | |
| "pageElement":"//li[a/@class='search-works-thumb relative']", | |
| "nextLink":"//span[@class='page-num-on']/following-sibling::a[1]", | |
| "wedata.net.id":76508 | |
| }, | |
| { | |
| "url":"^http://www\\.j-cast\\.com/", | |
| "pageElement":"//div[@class='entry-text-body']", | |
| "nextLink":"//span[@class='current']/following-sibling::a[1]", | |
| "wedata.net.id":31357 | |
| }, | |
| { | |
| "url":"^http://www\\.dxy\\.cn/bbs/", | |
| "pageElement":"//table[@class='post-table']/tbody/tr|id('postcontainer')/*", | |
| "nextLink":"//div[@class='num']/span[@class='current']/following-sibling::a[1]", | |
| "wedata.net.id":64301 | |
| }, | |
| { | |
| "url":"^http://2d\\.moe\\.hm/miku/", | |
| "pageElement":"//table/tbody/tr[td]", | |
| "nextLink":"//p[@class='bline']/strong/following-sibling::a", | |
| "wedata.net.id":32318 | |
| }, | |
| { | |
| "url":"^http://www\\.pahoo\\.org/.", | |
| "pageElement":"//div[@class='cassette']", | |
| "nextLink":"id('nextPage')", | |
| "wedata.net.id":54732 | |
| }, | |
| { | |
| "url":"^http://www\\.milanoo\\.jp/", | |
| "pageElement":"//dl[@class='goods_item gallery_display']", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":54693 | |
| }, | |
| { | |
| "url":"^http://m\\.facebook\\.com/", | |
| "pageElement":"//div[starts-with(@id,'u_0_')][not(ancestor::div[starts-with(@id,'u_0_')])]", | |
| "nextLink":"//a[span='See More Stories']", | |
| "wedata.net.id":29073 | |
| }, | |
| { | |
| "url":"http://blogring\\.info/list", | |
| "pageElement":"//tr[@class='entry-tr']", | |
| "nextLink":"//li[@class='active']/following-sibling::li[1]/a", | |
| "wedata.net.id":79981 | |
| }, | |
| { | |
| "url":"^http://u\\.magipoka\\.net/", | |
| "pageElement":"//div[@class='thread clearfix']", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":70064 | |
| }, | |
| { | |
| "url":"^http://www\\.macget\\.net/", | |
| "pageElement":"//ul[@class='section clearfix']", | |
| "nextLink":"//div[@class=\"pagenavi clearfix\"]/a[@class=\"next page-numbers\"][last()]", | |
| "wedata.net.id":76500 | |
| }, | |
| { | |
| "url":"^https://nanapi\\.jp/search", | |
| "pageElement":"//div[@class='themelist-caset clearfix']", | |
| "nextLink":"//a[@rel='prev']", | |
| "wedata.net.id":31053 | |
| }, | |
| { | |
| "url":"^http://www\\.21ccom\\.net/", | |
| "pageElement":"//div[@class='boxLe']/div/ul/li", | |
| "nextLink":"id('pages')/span/following-sibling::a[1]", | |
| "wedata.net.id":60969 | |
| }, | |
| { | |
| "url":"^http://www\\.autocar\\.jp/", | |
| "pageElement":"id(\"page_links\")[id(\"textArea\")[count(./div)=1]]/preceding-sibling::*|id(\"textArea\")[count(./div)>1]/div[1]|id(\"mainImage\")/img", | |
| "nextLink":"//a[@class=\"next\"]", | |
| "wedata.net.id":80861 | |
| }, | |
| { | |
| "url":"^http://store\\.act2\\.com/", | |
| "pageElement":"//li[contains(@class,\"grid_3 item\")]", | |
| "nextLink":"//a[@class=\"next i-next\"]", | |
| "wedata.net.id":36623 | |
| }, | |
| { | |
| "url":"^http://pinktentacle\\.com/", | |
| "pageElement":"//div[contains(@id,'post-')]", | |
| "nextLink":"//div[@class='navigation clear']/div[@class='bottom_left']/a", | |
| "wedata.net.id":1935 | |
| }, | |
| { | |
| "url":"^http://www\\.tinami\\.com/", | |
| "pageElement":"//div[@class=\"pager\"]/following-sibling::node()[following::div[@class=\"pager\"]]|//div[@class=\"pager\"]/preceding-sibling::node()[preceding::div[@class=\"pager\"]]", | |
| "nextLink":"id(\"next-page\")/a", | |
| "wedata.net.id":1640 | |
| }, | |
| { | |
| "url":"^http://shinh\\.skr\\.jp/m/", | |
| "pageElement":"//div[@class=\"day\"]", | |
| "nextLink":"//span[@class=\"adminmenu\"][2]/a[not(@href=\"./\")]", | |
| "wedata.net.id":32448 | |
| }, | |
| { | |
| "url":"^http://2-5-d\\.jp/feature/", | |
| "pageElement":"//div[@class='feature_text article-medium']/*", | |
| "nextLink":"//a[span/@class='paginateNext']", | |
| "wedata.net.id":72581 | |
| }, | |
| { | |
| "url":"^http://www\\.ranwen\\.org/", | |
| "pageElement":"id('content')", | |
| "nextLink":"//div[@class=\"bottem2\"]/a[last()]", | |
| "wedata.net.id":76955 | |
| }, | |
| { | |
| "url":"^.+://[^/]+\\.tumblr\\.com/", | |
| "pageElement":"//*[count(*[.//a[@class='permalink' or img/@class='permalink' or ../@class='date' or contains(@title,'permalink') or @class='fecha' or contains(@href,'/post/')]| .//div[contains(concat(' ',normalize-space(@class),' '),' permalink ')]/a])>=4]/*[.//a[@class='permalink' or img/@class='permalink' or ../@class='date' or contains(@title,'permalink') or @class='fecha' or contains(@href,'/post/')] | .//div[contains(concat(' ',normalize-space(@class),' '),' permalink ')]/a]", | |
| "nextLink":"//a[contains(@href,'/page/')][number(substring-after(self::a/@href,'/page/'))-number(substring-after(preceding::a[contains(@href,'/page/')][1]/@href,'/page/')) = 2 or number(substring-after(self::a/@href,'/page/'))-number(substring-after(following::a[contains(@href,'/page/')][1]/@href,'/page/')) = 2]|//a[starts-with(@href,'/page/') or contains(@href,'/search/') or contains(@href,'/tagged/')][contains(@href,'/page/2')][number(substring-after(following::a[contains(@href,'/page/')][1]/@href,'/page/')) != 4 and number(substring-after(preceding::a[contains(@href,'/page/')][1]/@href,'/page/')) != 4]", | |
| "wedata.net.id":681 | |
| }, | |
| { | |
| "url":"^http://www\\.mokkels\\.nl/", | |
| "pageElement":"id('content')/div[@class='block']", | |
| "nextLink":"//a[text()='VOLGENDE']", | |
| "wedata.net.id":65551 | |
| }, | |
| { | |
| "url":"^http://mercuru\\.jp/search", | |
| "pageElement":"//ul[@class='gridList']/li", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":30784 | |
| }, | |
| { | |
| "url":"^http://forum\\.51nb\\.com/", | |
| "pageElement":"//div[@class='logo']/form[last()]//tr[.//img]|//form/table[@class='t_rown']", | |
| "nextLink":"//a[@class=\"p_curpage\"]/following-sibling::a[1][@class=\"p_num\"]", | |
| "wedata.net.id":36124 | |
| }, | |
| { | |
| "url":"^http://news\\.mynavi\\.jp/", | |
| "pageElement":"//div[@class=\"articleContent\"]|//p[@class=\"lyt-hdg-03-03\"]|id(\"str-contentsleft\")/div[@class=\"lyt-box-02\"][./ul[contains(@class,\"type\")] or ./table]", | |
| "nextLink":"//link[@rel='next']|//li[@class='nxt'][not(//link/@rel='next')]/a", | |
| "wedata.net.id":55843 | |
| }, | |
| { | |
| "url":"^http://mangafox\\.(me|to)/", | |
| "pageElement":"id(\"viewer\")//a[img]|//div[@class=\"content\"]|//div[@class=\"lcol\"]/article[contains(@class,\"col\")]//li[1]/following-sibling::li", | |
| "nextLink":"//a[@class=\"btn next_page\"]|//select[@name=\"select_chapter\"]/following-sibling::a|//a[@class=\"page next\"]", | |
| "wedata.net.id":30751 | |
| }, | |
| { | |
| "url":"^http://jimhillmedia\\.com/", | |
| "pageElement":"//ul[starts-with(@class,'content-list')]", | |
| "nextLink":"//a[@class='selected']/following-sibling::a[1]", | |
| "wedata.net.id":74712 | |
| }, | |
| { | |
| "url":"^http://507movements\\.com/", | |
| "pageElement":"//div[@class='main']", | |
| "nextLink":"//div[@class='right']/a[last()]", | |
| "wedata.net.id":77602 | |
| }, | |
| { | |
| "url":"^https://suche\\.gmx\\.net/", | |
| "pageElement":"id('searchResults portalNewsSearch')//li", | |
| "nextLink":"//li[@class='active']/following-sibling::li[1]/a[number()>0]", | |
| "wedata.net.id":32488 | |
| }, | |
| { | |
| "url":"^http://skyrim\\.jpn\\.org/", | |
| "pageElement":"id('sumbnail')//tr", | |
| "nextLink":"//li[@class='current']/following-sibling::li[1]/a", | |
| "wedata.net.id":72599 | |
| }, | |
| { | |
| "url":"^http://news\\.donga\\.com/", | |
| "pageElement":"//div[@class='articleList']", | |
| "nextLink":"//div[@class='page']/strong/following-sibling::a[1]", | |
| "wedata.net.id":54317 | |
| }, | |
| { | |
| "url":"^http://soso\\.huitu\\.com/", | |
| "pageElement":"//ul[@class='clearfix']/li", | |
| "nextLink":"//a[@class=\"n1\"]", | |
| "wedata.net.id":76979 | |
| }, | |
| { | |
| "url":"^http://www\\.asaeda\\.com/", | |
| "pageElement":"//div[@class='post']", | |
| "nextLink":"//link[@rel='prev']|//div[@class='alignright']/a[last()]", | |
| "wedata.net.id":25689 | |
| }, | |
| { | |
| "url":"^http://www\\.kukudm\\.com/", | |
| "pageElement":"id(\"comicmain\")/dd", | |
| "nextLink":"id(\"comicmain\")/preceding-sibling::table//td/a[last()-1][not(contains(@href,\"_1.htm\"))]", | |
| "wedata.net.id":80759 | |
| }, | |
| { | |
| "url":"^http://210\\.172\\.55\\.3/", | |
| "pageElement":"//ul[@class='item_list clearfix']", | |
| "nextLink":"//a[.='次へ>>']", | |
| "wedata.net.id":65441 | |
| }, | |
| { | |
| "url":"^https://hail2u\\.net/blog/", | |
| "pageElement":"//article", | |
| "nextLink":"//a[@rel='next prerender']", | |
| "wedata.net.id":55920 | |
| }, | |
| { | |
| "url":"^http://www\\.anuntul\\.ro/", | |
| "pageElement":"//tr[@id=\"lista_filtre\"][last()]/preceding-sibling::tr[not(@id=\"lista_filtre\")]", | |
| "nextLink":"//li[./a[@class=\"activ_page\"]]/following-sibling::li[1]/a", | |
| "wedata.net.id":34590 | |
| }, | |
| { | |
| "url":"^http://media\\.daum\\.net/", | |
| "pageElement":"id('listWrap')/ul/li", | |
| "nextLink":"//a[@class='btn_news btn_next']", | |
| "wedata.net.id":54188 | |
| }, | |
| { | |
| "url":"^http://www\\.movies\\.com/", | |
| "pageElement":"id('archives trailerSearchResults')//li|//div[@class='resultsGroup']/*", | |
| "nextLink":"//a[@class='paginate-next' or ../@class='expandList']", | |
| "wedata.net.id":80763 | |
| }, | |
| { | |
| "url":"^http://www\\.emusic\\.com/", | |
| "pageElement":"//ul[@class='grid']/li|//div[@class='archive-posts']/div[starts-with(@class,'emusic')]", | |
| "nextLink":"//a[@class='next' or ../@class='nav-next']", | |
| "wedata.net.id":29270 | |
| }, | |
| { | |
| "url":"^http://www\\.c-lab\\.link/", | |
| "pageElement":"//div[@class='articleImageBody']", | |
| "nextLink":"//div[@class='next']/a", | |
| "wedata.net.id":77185 | |
| }, | |
| { | |
| "url":"^http://www\\.quledu\\.com/", | |
| "pageElement":"id('htmlContent')", | |
| "nextLink":"id('htmlxiazhang')", | |
| "wedata.net.id":76987 | |
| }, | |
| { | |
| "url":"^http://ec\\.sod\\.co\\.jp/", | |
| "pageElement":"//div[@class=\"list-cont-d-base\" or @class=\"list-cont-base\"]", | |
| "nextLink":"//div[@class=\"pager-txt\"]/a[contains(text(),\"»\")]", | |
| "wedata.net.id":63920 | |
| }, | |
| { | |
| "url":"^http://findarticles\\.com/", | |
| "pageElement":"//div[@class='orgr']/*", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":34195 | |
| }, | |
| { | |
| "url":"http://dl.ndl.go.jp/search/", | |
| "pageElement":"id('search-result-list')//tr", | |
| "nextLink":"//li[@class='paging-next']/a", | |
| "wedata.net.id":29302 | |
| }, | |
| { | |
| "url":"^http://www\\.osnews\\.com/", | |
| "pageElement":"id('contentbox')/*[starts-with(@class,'item')or @class='csshide']", | |
| "nextLink":"id('navdiv2')//a[contains(.,'Older')]", | |
| "wedata.net.id":42117 | |
| }, | |
| { | |
| "url":"^http://mkph\\.com/(?!\\?p)", | |
| "pageElement":"id(\"content\")", | |
| "nextLink":"//link[@rel=\"next\"]", | |
| "wedata.net.id":42122 | |
| }, | |
| { | |
| "url":"^http://nerdapproved\\.com/", | |
| "pageElement":"//div[starts-with(@class,'post')]", | |
| "nextLink":"//*[@class='previous_posts']/a", | |
| "wedata.net.id":32556 | |
| }, | |
| { | |
| "url":"^http://www\\.tested\\.com/", | |
| "pageElement":"//section[@class='blogroll']/article|//ul[@class='archive-list']/li", | |
| "nextLink":"//a[@class='next' or @class='step next']", | |
| "wedata.net.id":77717 | |
| }, | |
| { | |
| "url":"^http://www\\.pajiba\\.com/", | |
| "pageElement":"//div[@class='content']/br[last()]/preceding-sibling::*", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":77159 | |
| }, | |
| { | |
| "url":"^http://www\\.asagei\\.com/", | |
| "pageElement":"id('content')/div[contains(@class,'post')]", | |
| "nextLink":"//link[@rel=\"prev\"]", | |
| "wedata.net.id":77727 | |
| }, | |
| { | |
| "url":"^http://www\\.koreus\\.com/", | |
| "pageElement":"//div[@class='col-md-9']/div[@class='row']/div|id('centercolumn content')/*[starts-with(@class,'item') or self::br]", | |
| "nextLink":"//li[@class='active']/following-sibling::li[1]/a|id('content')/div[1]//b/following-sibling::a[1]", | |
| "wedata.net.id":32566 | |
| }, | |
| { | |
| "url":"^http://bookman\\.co\\.jp/.", | |
| "pageElement":"//div[@class='the_thumb_wrap']/*[not(@class='breadcrumb')]", | |
| "nextLink":"//div[@class='nav-next']/a", | |
| "wedata.net.id":64828 | |
| }, | |
| { | |
| "url":"^http://recode\\.net/search", | |
| "pageElement":"//div[@class='c-river__entry']", | |
| "nextLink":"//a[contains(@class,'c-pagination__next')]", | |
| "wedata.net.id":77346 | |
| }, | |
| { | |
| "url":"^http://www\\.snopes\\.com/", | |
| "pageElement":"//ul[@class='post-list']/li", | |
| "nextLink":"//li[@class='next-page ']/a", | |
| "wedata.net.id":77519 | |
| }, | |
| { | |
| "url":"^http://www\\.ekaki3\\.net/", | |
| "pageElement":"id(\"searchResult result\")", | |
| "nextLink":"//div[contains(concat(\" \", @class, \" \"), \" Pager \")]//a[contains(concat(\" \", @class, \" \"), \" next \")]|//a[contains(text(), \"\u6b21\u306e\u30da\u30fc\u30b8\")]", | |
| "wedata.net.id":45526 | |
| }, | |
| { | |
| "url":"^http://www\\.zimbio\\.com/", | |
| "pageElement":"//div[@class='eventWrapper']/div[@class='_c'][//div/@class='serMore']|//div[@class='_c' or @class='content-dark']/ul[@class='thumbnail-strip']/li[not(//div/@class='serMore')]|//div[@class='proWrapper']/div|//div[@class='articleWrapper' or @class='serList' or @class='pollContent']/*|//div[@class='recentStoryModule tile-layout' or @class='topicZines']", | |
| "nextLink":"id('Container')//font/following-sibling::a[1]|//a[@class='fRight hd2']", | |
| "wedata.net.id":77351 | |
| }, | |
| { | |
| "url":"^https://www\\.froma\\.com/", | |
| "pageElement":"id(\"jsi-job-article\")/div", | |
| "nextLink":"//link[@rel=\"next\"]", | |
| "wedata.net.id":45552 | |
| }, | |
| { | |
| "url":"^https://deview\\.co\\.jp/.", | |
| "pageElement":"//div[@class='photo_box' or @class='audition_box opened']", | |
| "nextLink":"//div[contains(@class,'page_nation')]/a[.='≫' or .='次ページ']", | |
| "wedata.net.id":52852 | |
| }, | |
| { | |
| "url":"^https://bbs\\.popgo\\.org/", | |
| "pageElement":"id('threadlist')/tr[@class='tr3']|//div[@class='read_t']", | |
| "nextLink":"//div[@class='pages']/b/following-sibling::a[1]", | |
| "wedata.net.id":76424 | |
| }, | |
| { | |
| "url":"^http://www\\.webdoku\\.jp/", | |
| "pageElement":"//div[contains(concat(' ', @class, ' '), ' entry ') or starts-with(@id, 'entry-')] | //p[@class='contentNavi']/following-sibling::ul[@id='footlink']|//div[@class='item clearfix']", | |
| "nextLink":"//link[contains(concat(' ', @rel, ' '),' prev ')] | //*[self::p or self::div][@class='contentNavi']/a[starts-with(.,'≪ ') or contains(., '前')]|//p[@class='rightNavi']/a[contains(@href,'index_old')]", | |
| "wedata.net.id":63656 | |
| }, | |
| { | |
| "url":"^http://eromangacafe\\.com/", | |
| "pageElement":"//div[@id=\"content\"]", | |
| "nextLink":"//a[@class=\"nextpostslink\"]", | |
| "wedata.net.id":80768 | |
| }, | |
| { | |
| "url":"^http://blog\\.stco\\.info/", | |
| "pageElement":"//div[@class=\"entry\"]", | |
| "nextLink":"//div[@class=\"page\"]/a[last()]", | |
| "wedata.net.id":25977 | |
| }, | |
| { | |
| "url":"^http://anime\\.eiga\\.com/", | |
| "pageElement":"//div[@class='newsDetailBox clearfix']/div[@class='pageInfoArea02']/preceding-sibling::*|//ul[@class='newsContainer']/li|//div[@class='tvScheList clearfix']", | |
| "nextLink":"//a[@rel='next' or ../@class='nextWeek']", | |
| "wedata.net.id":77517 | |
| }, | |
| { | |
| "url":"^http://.+\\.engadget\\.com", | |
| "pageElement":"//div[div/@class='container@m container@tp' or @class='commentlinks']|id('body')/article", | |
| "nextLink":"//div[@class='table-cell' or @class='container@tp-']/a|//a[@rel='prev' or ../@class='next_pg']", | |
| "wedata.net.id":32693 | |
| }, | |
| { | |
| "url":"^http://www\\.sankei\\.com/", | |
| "pageElement":"//article/div[@class='fontMiddiumText']|id(\"primary\")/article/*[not(self::h1)]|//section[@class='indexText clearfix']/ul/li", | |
| "nextLink":"//a[@class='pageNext']", | |
| "wedata.net.id":76399 | |
| }, | |
| { | |
| "url":"^http://technorati\\.com/.+", | |
| "pageElement":"//div[starts-with(@class,'td_mod_search td_mod_wrap ')]", | |
| "nextLink":"//a[img/@class='td-retina right-arrow']", | |
| "wedata.net.id":727 | |
| }, | |
| { | |
| "url":"^http://ecchi\\.iwara\\.tv/", | |
| "pageElement":"//div[@class=\"views-responsive-grid views-responsive-grid-horizontal views-columns-4\"]", | |
| "nextLink":"//li[@class=\"pager-next\"]/a", | |
| "wedata.net.id":80977 | |
| }, | |
| { | |
| "url":"^http://store\\.otaku\\.ru/", | |
| "pageElement":"//div[@class='catalog_product' or @style='clear:both;']", | |
| "nextLink":"//p/text()[contains(.,']')]/following-sibling::a[1]", | |
| "wedata.net.id":30179 | |
| }, | |
| { | |
| "url":"^http://www\\.fropky\\.com/", | |
| "pageElement":"//div[@class=\"hidden-xs\"][./a]/preceding-sibling::*", | |
| "nextLink":"//a[@class=\"btn btn-default pull-right\"]", | |
| "wedata.net.id":80817 | |
| }, | |
| { | |
| "url":"^http://group\\.ameba\\.jp/", | |
| "pageElement":"//div[@class='autopagerize_page_element']//li", | |
| "nextLink":"//a[@class='fwd']", | |
| "wedata.net.id":57419 | |
| }, | |
| { | |
| "url":"^http://www\\.bl-ink\\.net/", | |
| "pageElement":"//div[@class='comic_list' or @class='auth']|//img[@class='space']|//table[@class='mgzn-cover' or @class='mgzn-color']", | |
| "nextLink":"//a[@class='nextpostslink' or @rel='prev']", | |
| "wedata.net.id":65377 | |
| }, | |
| { | |
| "url":"^http://mangahelpers\\.com/", | |
| "pageElement":"//table[@class='listing']/tbody/tr", | |
| "nextLink":"//a[@class='button' and contains(., 'next')]", | |
| "wedata.net.id":27137 | |
| }, | |
| { | |
| "url":"^https://www\\.aines\\.net/", | |
| "pageElement":"//div[@class='a2_list2']", | |
| "nextLink":"//li[span/@class='noLink']/following-sibling::li[1]/a", | |
| "wedata.net.id":55978 | |
| }, | |
| { | |
| "url":"^http://www\\.askmen\\.com/", | |
| "pageElement":"(//div[@class='currentPage clearfix']/following-sibling::*[not(a/text()='Next Page')]|//div[starts-with(@class,'theArticle') and contains(@class,'cleanprint-article')]/text())[following-sibling::p[last()]]", | |
| "nextLink":"//a[@class='jumpToPage' and .='Next Page']", | |
| "wedata.net.id":30144 | |
| }, | |
| { | |
| "url":"^http://www\\.scpr\\.org/.+", | |
| "pageElement":"//div[@class='show-episode episode' or starts-with(@class,'cbase') and not(//div/@class='show-episode episode')]", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":77069 | |
| }, | |
| { | |
| "url":"^http://www\\.shorpy\\.com/", | |
| "pageElement":".//div[@class=\"node\"]", | |
| "nextLink":".//div[@class=\"pager\"]/a[contains(@class,\"pager-next\")]", | |
| "wedata.net.id":33393 | |
| }, | |
| { | |
| "url":"^http://masterherald\\.com/", | |
| "pageElement":"//div[starts-with(@class,'base-box')][not(//div/@class='entry-content')]|//div[@class='news-list']/article|//div[@class='entry-content']/div[@class='entry clearfix']/preceding-sibling::*", | |
| "nextLink":"//span[@class='current']/following-sibling::a[1]", | |
| "wedata.net.id":77509 | |
| }, | |
| { | |
| "url":"^http://git-scm\\.com/book/", | |
| "pageElement":"id('main')/div/*[not(@id='nav')]", | |
| "nextLink":"id('nav')/a[.='next']", | |
| "wedata.net.id":29466 | |
| }, | |
| { | |
| "url":"^http://www\\.soku\\.com/rn", | |
| "pageElement":"//div[@class='sk-vlist clearfix']/*rn", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":46144 | |
| }, | |
| { | |
| "url":"^http://www\\.kidol\\.jp/i/", | |
| "pageElement":"id('photo-list')/div", | |
| "nextLink":"//a[@href=\"#top\"]/following-sibling::br[1]/preceding-sibling::a[@accesskey=\"6\"]", | |
| "wedata.net.id":29474 | |
| }, | |
| { | |
| "url":"^http://s\\.maho\\.jp/book/", | |
| "pageElement":"id(\"book-main\")/*[@class='ttl-secondary' or @class='inner row']", | |
| "nextLink":"//li[@class=\"next\"]/a", | |
| "wedata.net.id":760 | |
| }, | |
| { | |
| "url":"^http://japan\\.cnet\\.com/", | |
| "pageElement":"//div[starts-with(@class,\"block20\")][./div[@id=\"pagination\"] or ./following-sibling::div[@id=\"pagination\"]]/ul/li|//div[@class=\"article_body\" or @class=\"leaf_body article_body\"]", | |
| "nextLink":"id('pagination')//li[@class='next']/a", | |
| "wedata.net.id":432 | |
| }, | |
| { | |
| "url":"^http://www\\.plurk\\.com/m", | |
| "pageElement":"//div[contains(@class,\"pagination\")]/preceding-sibling::div", | |
| "nextLink":"//div[@class=\"pagination clearfix next\"]/a|//div[@class=\"pagination clearfix back next\"][count(./a)>1]/a[last()]", | |
| "wedata.net.id":29946 | |
| }, | |
| { | |
| "url":"^http://www\\.141jav\\.com/", | |
| "pageElement":"//div[@class=\"content-container\"]/*", | |
| "nextLink":"//div[@class=\"pagination\"]/a[last()]", | |
| "wedata.net.id":76351 | |
| }, | |
| { | |
| "url":"^http://www\\.gendama\\.jp/", | |
| "pageElement":"//section[@class='serviceTable']", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":65317 | |
| }, | |
| { | |
| "url":"^http://html5gallery\\.com/", | |
| "pageElement":"id('primary')/article", | |
| "nextLink":"//div[@class=\"next-previous\"][count(./a)>1 or ./a[@href=\"http://html5gallery.com/page/2/\"]]/a[1]", | |
| "wedata.net.id":33253 | |
| }, | |
| { | |
| "url":"^http://www\\.gizmodo\\.jp/", | |
| "pageElement":"//div[contains(@class,'autopagerize_page_element')]/*[starts-with(@class,'date') or starts-with(@class,'entry entry')]|//div[@class='entry_body']/preceding-sibling::*|//div[@class='cXenseParse']", | |
| "nextLink":"//a[@rel='next' or ../@class='next']", | |
| "wedata.net.id":76350 | |
| }, | |
| { | |
| "url":"^https?://github\\.com/blog", | |
| "pageElement":"//div[@class='posts']/*", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":2240 | |
| }, | |
| { | |
| "url":"^http://motherless\\.com/.+", | |
| "pageElement":"//div[@class=\"content-wrapper\"]/div/div[contains(@class,\"thumb-container\")] | //*[@id=\"content\"]/div/div[@class=\"row\"]/div[@class=\"col-md-12\"][1]/div/div/div/div[@class=\"col-md-12\"]/div| //*[@id=\"group-member-thumbs-container\"]/div ", | |
| "nextLink":"//*[@id=\"content\"]/div/div[@class=\"content-wrapper\"]/div/div/a[text()=\"NEXT »\"] | //a[text()=\"NEXT »\"] | ", | |
| "wedata.net.id":77149 | |
| }, | |
| { | |
| "url":"^http://www\\.akiyan\\.com/", | |
| "pageElement":"//article", | |
| "nextLink":"//a[.='« 前ページへ']", | |
| "wedata.net.id":932 | |
| }, | |
| { | |
| "url":"^http://womo\\.nconc\\.net/", | |
| "pageElement":"id(\"contents\")/div[@class=\"section\"]", | |
| "nextLink":"//a[@title=\"Go to next page\"]", | |
| "wedata.net.id":63206 | |
| }, | |
| { | |
| "url":"^https://www\\.kuvva\\.com/", | |
| "pageElement":"//section[@class='thumb-grid']/ul/li", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":74418 | |
| }, | |
| { | |
| "url":"^https://www\\.conrad\\.de/", | |
| "pageElement":"//ul[@class='ccpProductList']/li", | |
| "nextLink":"//a[@class='next active']", | |
| "wedata.net.id":46311 | |
| }, | |
| { | |
| "url":"^http://www\\.cnbc\\.com/.+", | |
| "pageElement":"//ul[@class='stories_assetlist']/li", | |
| "nextLink":"//a[.='Next »']", | |
| "wedata.net.id":26767 | |
| }, | |
| { | |
| "url":"^http://avxhome\\.\\w{2,3}/", | |
| "pageElement":"//div[@class='col-md-12 article' and div[1]/@class='row']", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":77079 | |
| }, | |
| { | |
| "url":"http://blog\\.syuhari\\.jp/", | |
| "pageElement":"//div[starts-with(@id,'post-')]", | |
| "nextLink":"//div[@class='alignright']/a", | |
| "wedata.net.id":26750 | |
| }, | |
| { | |
| "url":"^http://allabout\\.co\\.jp/", | |
| "pageElement":"//div[@id=\"popin_read\"]/div/ul", | |
| "nextLink":"//a[(text()=\"次のページへ\")]", | |
| "wedata.net.id":414 | |
| }, | |
| { | |
| "url":"^http://screenrant\\.com/.+", | |
| "pageElement":"//section[contains(@class,'latest-news')]/ul/li|//div[@class='article-body']/*[not(self::footer or contains(@class,'next-btn'))]|//span[p/span/@class='contentjumpnumber']/preceding-sibling::h2[1]/preceding-sibling::*", | |
| "nextLink":"//link[@rel='next'][not(contains(@href,'http://screenrant.com/page/'))]|//a[@rel='next'][not(//link/@rel='next')]", | |
| "wedata.net.id":77441 | |
| }, | |
| { | |
| "url":"^http://www\\.animate\\.tv/", | |
| "pageElement":"//div[@class='box'][div/@class='textBox']", | |
| "nextLink":"//div[@class='next']/a", | |
| "wedata.net.id":64930 | |
| }, | |
| { | |
| "url":"^http://mago\\.pepper\\.jp/", | |
| "pageElement":"//table[@width=\"520\"]", | |
| "nextLink":"//a[img[@src=\"index-img/tonexticon.jpg\"]]", | |
| "wedata.net.id":29571 | |
| }, | |
| { | |
| "url":"^https://pkcr\\.jp/category", | |
| "pageElement":"//ul[@class='ContentsImgList']/li", | |
| "nextLink":"//ul[@class='ListNavi']/li[@class='crt']/following-sibling::li[1]/a", | |
| "wedata.net.id":46329 | |
| }, | |
| { | |
| "url":"^http://ss2ch\\.r401\\.net/", | |
| "pageElement":"//div[@class='news' or @class='date']", | |
| "nextLink":"//a[@class='next_page']", | |
| "wedata.net.id":76307 | |
| }, | |
| { | |
| "url":"^https://onepagelove\\.com/", | |
| "pageElement":"//div[@class='thumb']", | |
| "nextLink":"//div[@class='browsing-nav-right']/a", | |
| "wedata.net.id":33015 | |
| }, | |
| { | |
| "url":"^http://fox\\.jim2ch\\.net/", | |
| "pageElement":"//div[@class='ImageElements']", | |
| "nextLink":"//a[@class='ImagePageLinkLF']rn", | |
| "wedata.net.id":33170 | |
| }, | |
| { | |
| "url":"^https://thinkit\\.co\\.jp/", | |
| "pageElement":"//div[@class='field-item even'][h2]/*[not(self::h2)]", | |
| "nextLink":"//li[@class='pager-next']/a", | |
| "wedata.net.id":33141 | |
| }, | |
| { | |
| "url":"^http://www\\.jav008\\.com/", | |
| "pageElement":"//div[@class='posts']", | |
| "nextLink":"//a[@class='post-nav-newer fright']", | |
| "wedata.net.id":77770 | |
| }, | |
| { | |
| "url":"^http://knowyourmeme\\.com/", | |
| "pageElement":"id('feed_items entries_list')/*|//table[@class='forum_topics' or @class='video_list']/tbody/tr", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":76330 | |
| }, | |
| { | |
| "url":"^http://movie\\.hxsd\\.com/", | |
| "pageElement":"//p[a/@title='下一张图片:']|//div[@class='archlist']", | |
| "nextLink":"//a[contains(.,'下一页')][@href]", | |
| "wedata.net.id":74212 | |
| }, | |
| { | |
| "url":"^http://blogofmobile\\.com/", | |
| "pageElement":"//div[@class='post']", | |
| "nextLink":"//a[.='古い記事へ']", | |
| "wedata.net.id":76320 | |
| }, | |
| { | |
| "url":"^http://www\\.cotopa\\.com/", | |
| "pageElement":"id('posts')", | |
| "nextLink":"//a[@class='archive-nav-older fleft']", | |
| "wedata.net.id":26697 | |
| }, | |
| { | |
| "url":"^https://wordpress\\.org/.+", | |
| "pageElement":"//div[@class='col-7']/*[self::h4 or @class='storycontent']|//div[@class='plugin-group']|//table[@class='widefat']/tbody/tr", | |
| "nextLink":"//li[@class='active_page']/following-sibling::li[1]/a|//a[@class='next page-numbers']", | |
| "wedata.net.id":569 | |
| }, | |
| { | |
| "url":"^http://www\\.infotop\\.jp/", | |
| "pageElement":"//table[@class='noborder']", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":33402 | |
| }, | |
| { | |
| "url":"^http://moxile\\.net/blog/", | |
| "pageElement":"//div[@class='post']", | |
| "nextLink":"//a[.='« Previous Entries']", | |
| "wedata.net.id":76319 | |
| }, | |
| { | |
| "url":"^http://vector4free\\.com/", | |
| "pageElement":"//div[@class='row-fluid']", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":819 | |
| }, | |
| { | |
| "url":"^http://ava\\.pmang\\.jp/n", | |
| "pageElement":"//table[@class='news_list' or @class='list']//tr[td]", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":77472 | |
| }, | |
| { | |
| "url":"^http://\\w+\\.porn\\.com/", | |
| "pageElement":"//ul[contains(@class,\"listThumbs\") or @class=\"listDVDs\"]/li|//div[@class=\"main\"]/ul[@class=\"listProfiles\"]/li", | |
| "nextLink":"//div[@class=\"pager\"]//a[@class=\"active\"]/following-sibling::a[1]", | |
| "wedata.net.id":57130 | |
| }, | |
| { | |
| "url":"^http://philgrocers\\.com/", | |
| "pageElement":"//div[@class='product-list']/*", | |
| "nextLink":"//div[@class='links']/b/following-sibling::a[1]", | |
| "wedata.net.id":63367 | |
| }, | |
| { | |
| "url":"^http://tower\\.jp/search/", | |
| "pageElement":"//table[contains(@class,'searchListTable')]/following-sibling::*[following-sibling::div/@class='searchPagerWrap02']", | |
| "nextLink":"//a[img/@class='next rollImg']", | |
| "wedata.net.id":76329 | |
| }, | |
| { | |
| "url":"^http://www\\.uumnp\\.com/", | |
| "pageElement":"id('wf-main')", | |
| "nextLink":"//li[@class='thisclass']/following-sibling::li[1]/a", | |
| "wedata.net.id":77083 | |
| }, | |
| { | |
| "url":"^http://www\\.bored\\.com/", | |
| "pageElement":"//div[@class='row' and div/@class='listitem listitem-ad-container']/*", | |
| "nextLink":"//a[span/@class='icon icon-chevron-right']", | |
| "wedata.net.id":76312 | |
| }, | |
| { | |
| "url":"^http://eleshop\\.jp/shop/", | |
| "pageElement":"//div[@class=\"goods_\"]", | |
| "nextLink":"//img[@alt=\"次のページ\"]/..", | |
| "wedata.net.id":56946 | |
| }, | |
| { | |
| "url":"^https://openuserjs\\.org/", | |
| "pageElement":"//table[starts-with(@class,'table table-hover')][.//th]//tr[@class='tr-link']|//div[@class='topic-post list-group-item' or @class='topic-title row container-fluid']", | |
| "nextLink":"//li[@class='active'][number()>0]/following-sibling::li[1]/a", | |
| "wedata.net.id":77129 | |
| }, | |
| { | |
| "url":"^https://coordisnap\\.com/", | |
| "pageElement":"//*[@class='thumbBlockLink' or @class='listTag cf']//li", | |
| "nextLink":"id('next')", | |
| "wedata.net.id":77082 | |
| }, | |
| { | |
| "url":"^http://wog\\.jpn\\.org/h/", | |
| "pageElement":"//div[@class=\"article\"]|//h2[@class=\"pageTitle\"][not(//ul[@class=\"pager\"])]|id(\"alpha-inner\")/*[not(@class=\"content-nav\")]", | |
| "nextLink":"//li[@class=\"prev\"]/a|//a[@class=\"link_next\"]|//p[@class=\"content-nav\"]/a[1][not(@href=\"http://wog.jpn.org/h/\")]", | |
| "wedata.net.id":46325 | |
| }, | |
| { | |
| "url":"^http://www.cliphunter.com", | |
| "pageElement":"//div[@class=\"main_content\" or @class=\"tab-content\"]/ul[contains(concat(\" \", @class, \" \"), \"thumblist\")]/li[@itemtype]", | |
| "nextLink":"//a[(text()=\"Next >\")]", | |
| "wedata.net.id":77477 | |
| }, | |
| { | |
| "url":"^http://ipop.xyz/archives/", | |
| "pageElement":"//div[@class=\"sns\"]/preceding-sibling::p[1]/preceding-sibling::*", | |
| "nextLink":"//div[@class=\"p-navi clearfix\"]/dl[count(./dd)>1]/dd[1]/a|//div[@class=\"p-navi clearfix\"]/dl[count(./dd)=1]/dd/a[number(substring-after(//link[@rel=\"canonical\"]/@href,\"http://ipop.xyz/archives/\"))>number(substring-after(@href,\"http://ipop.xyz/archives/\"))]", | |
| "wedata.net.id":80802 | |
| }, | |
| { | |
| "url":"^http://digicame-info.com/", | |
| "pageElement":"id(\"alpha-inner\")", | |
| "nextLink":"//link[@rel=\"prev\"]", | |
| "wedata.net.id":77444 | |
| }, | |
| { | |
| "url":"^https?://www\\.daft\\.ie/", | |
| "pageElement":"//div[@class='box']", | |
| "nextLink":"//li[@class='next_page']/a", | |
| "wedata.net.id":32959 | |
| }, | |
| { | |
| "url":"^http://photohito\\.com/.+", | |
| "pageElement":"//ul[@class='photo_list_centering']/*|id('container')", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":792 | |
| }, | |
| { | |
| "url":"^https://middle-edge\\.jp/", | |
| "pageElement":"//div[@class='article-content']/div[contains(@class,'article-item')]|//div[@class='col col-sm-6']/div/div[contains(@class,'list-group-item')]", | |
| "nextLink":"//li[@class='next_page']/a", | |
| "wedata.net.id":80801 | |
| }, | |
| { | |
| "url":"^https?://.+/bbstcon\\.php", | |
| "pageElement":"//table[@class='main wide']/tbody/tr[td]", | |
| "nextLink":"//a[.='下一页']", | |
| "wedata.net.id":29557 | |
| }, | |
| { | |
| "url":"^http://pimpandhost\\.com/", | |
| "pageElement":"//div[@id=\"contain\"]/div/div/div[2]", | |
| "nextLink":"//a[(text()=\"Next >\")]", | |
| "wedata.net.id":77494 | |
| }, | |
| { | |
| "url":"^http://zeromagazine\\.jp/", | |
| "pageElement":"//div[@class=\"content-inner\"]/*[not(self::div)]|//div[@class=\"content-inner\"]/div[not(@class)]|//div[@class=\"contentsarea\" or @class=\"img-with-aniamtion-wrap left\" or @class=\"row heading-title\"]|id(\"portfolio\")", | |
| "nextLink":"//link[@rel=\"next\"]", | |
| "wedata.net.id":63303 | |
| }, | |
| { | |
| "url":"^http://cal\\.syoboi\\.jp/", | |
| "insertBefore":"id(\"main\")/table/following-sibling::node()", | |
| "pageElement":"id(\"main\")/table", | |
| "nextLink":"//a[text()=\"\u6b21\u30da\u30fc\u30b8\"]", | |
| "wedata.net.id":765 | |
| }, | |
| { | |
| "url":"^http://variety\\.co\\.jp/", | |
| "pageElement":"//ul[@class=\"subNews\" or @class=\"search\"]/li", | |
| "nextLink":"//ul[@class=\"pagenation\"]/li[./div]/following-sibling::li[1]/a", | |
| "wedata.net.id":80798 | |
| }, | |
| { | |
| "url":"^http://www\\.biquge\\.la/", | |
| "pageElement":"id('content')", | |
| "nextLink":"//div[@class='bottem2']/a[contains(.,'下一章')]", | |
| "wedata.net.id":80787 | |
| }, | |
| { | |
| "url":"^http://www\\.e-nls\\.com/", | |
| "pageElement":"//table[@class='item-list01']|//table[@class='item-list01']/following-sibling::hr", | |
| "nextLink":"//a[text()='次へ>>']", | |
| "wedata.net.id":80811 | |
| }, | |
| { | |
| "url":"^http://hothardware\\.com/", | |
| "pageElement":"//div[@class='cl-item h-card']|//table[@class='content']//tr[td/@class='topicMain'][not(@class='topicRow post priorityRow announcement')]|//table[starts-with(@class,'content postContainer')]", | |
| "nextLink":"id('1_pager_Next')|//a[@title='Next Page']", | |
| "wedata.net.id":77431 | |
| }, | |
| { | |
| "url":"^http://pornorips\\.com/.+", | |
| "pageElement":"id(\"content-global\")/div[@class=\"content\" or @style]", | |
| "nextLink":"//a[text()=\"»»\"]", | |
| "wedata.net.id":77150 | |
| }, | |
| { | |
| "url":"^http://daimaoh\\.co\\.jp/", | |
| "pageElement":"//table[@class='item_list']", | |
| "nextLink":"//a[img[contains(@src,'page_next')]]", | |
| "wedata.net.id":80812 | |
| }, | |
| { | |
| "url":"^http://www\\.break\\.com/", | |
| "pageElement":"id('js-timestream-full')/div/div/article", | |
| "nextLink":"//div[@class='js-load-more ui-load-more']/a", | |
| "wedata.net.id":32755 | |
| }, | |
| { | |
| "url":"^http://www.pewglobal.org/", | |
| "pageElement":"id('content')/*[preceding-sibling::h1][following-sibling::div/@id='pagination']", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":74098 | |
| }, | |
| { | |
| "url":"^http://www\\.4tube\\.com/", | |
| "pageElement":"//span[@class=\"pagination\"]/ancestor::div[@class=\"section\"][1]", | |
| "nextLink":"//span[@class=\"pagination\"]/a[@class=\"next\"]", | |
| "wedata.net.id":32747 | |
| }, | |
| { | |
| "url":"^http://dailycaller\\.com/", | |
| "pageElement":"id('dc-word-up')", | |
| "nextLink":"//div[@class='readmore']/a", | |
| "wedata.net.id":33293 | |
| }, | |
| { | |
| "url":"^http://www\\.tokuma\\.jp/", | |
| "pageElement":"//ul[@class='bookinfo']/li", | |
| "nextLink":"//li[@class='textLink']/a[.='次']", | |
| "wedata.net.id":63184 | |
| }, | |
| { | |
| "url":"^http://[^.]+\\.webn\\.jp/", | |
| "pageElement":"//div[starts-with(@id, \"post-\")]", | |
| "nextLink":"//link[@rel=\"prev\"] | //div[@class=\"nav-previous\"]/a | //div[@class=\"navigation\"]/div[@class=\"alignleft\"]/a", | |
| "wedata.net.id":63183 | |
| }, | |
| { | |
| "url":"^http://iyec\\.omni7\\.jp/", | |
| "pageElement":"//div[@class='mod-shoppingContents_item']", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":30193 | |
| }, | |
| { | |
| "url":"^http://www\\.huihui\\.cn/", | |
| "pageElement":"//ul[@class='hui-list' or @class='guide-list' or (../@class='bd' and @class='clearfix')]", | |
| "nextLink":"//a[.='>' or .='下一页']", | |
| "wedata.net.id":73812 | |
| }, | |
| { | |
| "url":"^http://la\\.ma\\.la/blog/", | |
| "pageElement":"//div[@class=\"blog\"][./div[@class=\"blogbody\"]]", | |
| "nextLink":"//link[@rel=\"previous\"]|//a[@title=\"Go to next page\"]", | |
| "wedata.net.id":1250 | |
| }, | |
| { | |
| "url":"^http://kakaku\\.com/used/", | |
| "pageElement":"//table[@class='tblUsed']/tbody/tr[td]", | |
| "nextLink":"//span[@class='next']/a", | |
| "wedata.net.id":29438 | |
| }, | |
| { | |
| "url":"^https://ticketcamp\\.net/", | |
| "pageElement":"//section[contains(@class,'module-list-ticket')]/div/ul/li", | |
| "nextLink":"//div[@class='pagination']/ul/li[@class='next']/a", | |
| "wedata.net.id":77241 | |
| }, | |
| { | |
| "url":"^http://blogs\\.zoho\\.jp/", | |
| "pageElement":"//div[contains(@class,\"post_item\")]", | |
| "nextLink":"id(\"load_post\")/a", | |
| "wedata.net.id":33621 | |
| }, | |
| { | |
| "url":"^http://www\\.osx86\\.net/", | |
| "pageElement":"//div[@data-role=\"commentFeed\"]/form/*", | |
| "nextLink":"//li[@class='ipsPagination_next']/a", | |
| "wedata.net.id":77024 | |
| }, | |
| { | |
| "url":"^http://wetholefans\\.com/", | |
| "pageElement":"//DIV[@id=\"dle-content\"]", | |
| "nextLink":"//a[text()=\"Next\"]", | |
| "wedata.net.id":80821 | |
| }, | |
| { | |
| "url":"^http://blog\\.digg\\.com/", | |
| "pageElement":"//div[@class=\"post\" or @class=\"bottom\"]", | |
| "nextLink":"id(\"navigation\")[count(./a)>1 or ./a[@href=\"/page/2\"]]/a[last()]", | |
| "wedata.net.id":32611 | |
| }, | |
| { | |
| "url":"^http://omocoro\\.jp/kiji/", | |
| "pageElement":"//div[@class='page_navi']/preceding-sibling::*", | |
| "nextLink":"//div[@class='page_navi']/span/following-sibling::a", | |
| "wedata.net.id":76421 | |
| }, | |
| { | |
| "url":"^http://www\\.adbkm\\.com/", | |
| "pageElement":"//tr[./td[@class=\"list\"]]", | |
| "nextLink":"//a[@title=\"次のページ\"]", | |
| "wedata.net.id":53180 | |
| }, | |
| { | |
| "url":"^http://www\\.dl4all\\.ws/", | |
| "pageElement":"//div[@class='navigation']/preceding-sibling::*", | |
| "nextLink":"//div[@class='navigation']/span[number()>0]/following-sibling::a[1]", | |
| "wedata.net.id":77022 | |
| }, | |
| { | |
| "url":"^https://calil\\.jp/list.*", | |
| "pageElement":"//table[@id='wishlist_table']/tbody", | |
| "nextLink":"//div[@id='ccontent']/div[3]/ul/li[last()]/a", | |
| "wedata.net.id":77174 | |
| }, | |
| { | |
| "url":"^http://www\\.tjoob\\.com/", | |
| "pageElement":"id(\"mainsearch\")/div[contains(concat(\" \", @class, \" \"), \" vids \") or contains(concat(\" \", @class, \" \"), \" clear \")]", | |
| "nextLink":"//span[contains(concat(\" \", @class, \" \"), \" pagenumbers \")]/strong/following-sibling::a[1]", | |
| "wedata.net.id":55954 | |
| }, | |
| { | |
| "url":"^http://myanimelist\\.net/", | |
| "pageElement":"//*[starts-with(@id,'forumMsg') or starts-with(td/@class,'borderClass') or starts-with(@class,'ranking-list')]", | |
| "nextLink":"//*[@class='bgColor1' or @class='fl-r pb4']/text()[contains(.,']')]/following-sibling::a[1]|//a[@class='link-blue-box next']", | |
| "wedata.net.id":32563 | |
| }, | |
| { | |
| "url":"^http://blogs\\.wsj\\.com/", | |
| "pageElement":"id('postList')/li", | |
| "nextLink":"//li[@class='blognav_prev']/a", | |
| "wedata.net.id":41852 | |
| }, | |
| { | |
| "url":"^http://dic\\.pixiv\\.net/", | |
| "pageElement":"//article", | |
| "nextLink":"//a[@class='more']", | |
| "wedata.net.id":34064 | |
| }, | |
| { | |
| "url":"^http://www\\.cuoca\\.com/", | |
| "pageElement":"//div[starts-with(@class,'item_field clearfix')]/*", | |
| "nextLink":"//div[@class='page_send clearfix' or @class='paging_area']/strong/following-sibling::a[1]", | |
| "wedata.net.id":41642 | |
| }, | |
| { | |
| "url":"^http://www\\.aspect\\.jp/", | |
| "pageElement":"id(\"main\")//li[not(./ancestor::div[@class=\"page-navi\"])]", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":64827 | |
| }, | |
| { | |
| "url":"^https?://www\\.csfd\\.cz/", | |
| "pageElement":"//ul[@class='ui-posts-list']/li", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":55932 | |
| }, | |
| { | |
| "url":"^http://www\\.shobon\\.jp/", | |
| "pageElement":"//div[@class='BODY']/table//tr[@id]", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":30487 | |
| }, | |
| { | |
| "url":"^http://www\\.comico\\.jp/", | |
| "pageElement":"//table[contains(@class,\"m-table0\")]//tr[td]|//div[@class=\"m-list-episode02\"]//li|//div[@class=\"m-article-title\" or @class=\"m-article-metas\"]|//section[@class=\"m-section-detail__body\" or @class=\"o-mb20\"]|id(\"fb-root\")/preceding-sibling::hr[1]/preceding-sibling::*|//div[@class=\"info-detail01__content\"][not(id(\"fb-root\"))]|//h1[@class=\"m-title06\"]", | |
| "nextLink":"//a[@class='_next']|//p[@class='m-article-header__article-title-nav']/a[./i/@class='i-btn-next']|//li[@class='btn-set02__item01']/a[contains(@class,'m-btn-prev01')]", | |
| "wedata.net.id":75024 | |
| }, | |
| { | |
| "url":"^http://gnome-look\\.org/*", | |
| "pageElement":"//table[contains(concat(\" \", @class, \" \"), \" contentbox \")]//table[self::node()/tbody/tr[contains(concat(\" \", @class, \" \"), \" contentlistview \")] and position()=1]", | |
| "nextLink":"//span[contains(concat(\" \", @class, \" \"), \" pagerbutton2 \")]/a", | |
| "wedata.net.id":41336 | |
| }, | |
| { | |
| "url":"^http://www\\.tube8\\.com/", | |
| "pageElement":"//div[contains(concat(\" \",@class,\" \"), \" thumb-wrapper \" )]|//div[contains(concat(\" \",@class,\" \"), \" thumb-wrapper \" )][last()]/following-sibling::*[1][self::div]", | |
| "nextLink":"id(\"pagination_next\")", | |
| "wedata.net.id":27381 | |
| }, | |
| { | |
| "url":"^http://ryukyushimpo\\.jp/", | |
| "pageElement":"id('detail')/*", | |
| "nextLink":"//a[div/@class='prev-link float-left']", | |
| "wedata.net.id":64751 | |
| }, | |
| { | |
| "url":"^http://www\\.47news\\.jp/", | |
| "pageElement":"//div[@class='topContent']/ul|//div[@class='topContent'][div/@class='imageZone']/node()[preceding-sibling::div[1]][following-sibling::div[last()]]|id('mainContent')//div[@class='bgBB clearfix']//div[@class='blueOnBlueBg']/br[last()]/preceding-sibling::*[not(@class='pageNate in_the_box10_b')]|id('mainBlueBoxCenter')/div[@class='photoMini']|//div[@class='redAllInB']/*[not(@class='imageZoneTop clearfix')]", | |
| "nextLink":"(//div[@class='topContent']|//p[contains(@class,'pageNate')])/text()[string-length(.)>3]/following-sibling::a|//a[img/@alt='次へ']|id('bt_body')/a|id('mainContent')//div[@align='center']/a[img[contains(@src,'next')]]|id('mainContent')//p[@class='pageNate in_the_box10_b']/text()[not(a)][number(translate(self::text(),'|','')) ]/following-sibling::a[1]|id('mainContent')//li[@class='next']/a|id('mainBlueBoxCenter')//div[@class=' clear pageNateBox font14']/a[last()]|id('next')/a", | |
| "wedata.net.id":30494 | |
| }, | |
| { | |
| "url":"^http://alice-books\\.com/", | |
| "pageElement":"//div[@class='cf']", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":34526 | |
| }, | |
| { | |
| "url":"^http://socialtunes\\.net/", | |
| "pageElement":"id('main')/div[@class='box'][table]", | |
| "nextLink":"//img[@src=\"/images/arrow.gif\"]/following-sibling::a|id(\"current_page\")/following-sibling::a[1]", | |
| "wedata.net.id":76982 | |
| }, | |
| { | |
| "url":"^http://blog\\.s21g\\.com/", | |
| "pageElement":"id(\"articles\")/*", | |
| "nextLink":"//a[@class=\"back\"]", | |
| "wedata.net.id":2519 | |
| }, | |
| { | |
| "url":"^http://blog\\.mach3\\.jp/", | |
| "pageElement":"//div[@class='wdg-body']//section", | |
| "nextLink":"//nav[@class='wdg-next-page']/a", | |
| "wedata.net.id":41146 | |
| }, | |
| { | |
| "url":"^http://(.+)?slmame\\.com/", | |
| "pageElement":"//div[@class='blogbody']|id('bloglist')/div[@class='content']//li", | |
| "nextLink":"//a[.='Next Page']|//div[@class='content']/ul/preceding-sibling::div[1]/span/following-sibling::a[1][text()=number(//div[@class='content']/ul/preceding-sibling::div[1]/span/text())+1]", | |
| "wedata.net.id":1497 | |
| }, | |
| { | |
| "url":"^https?://pledgie\\.com/.+", | |
| "pageElement":"//div[@class='row'][div/@class='col-md-4 appendBottom']", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":1511 | |
| }, | |
| { | |
| "url":"^http://news\\.auone\\.jp/", | |
| "pageElement":"//div[@class='newsarea-box02']//li", | |
| "nextLink":"//a[.='次へ']", | |
| "wedata.net.id":60070 | |
| }, | |
| { | |
| "url":"^http://www\\.slzin\\.com/", | |
| "pageElement":"//div[@class='post']", | |
| "nextLink":"//a[@rel='prev']", | |
| "wedata.net.id":27424 | |
| }, | |
| { | |
| "url":"^http://7net\\.omni7\\.jp/", | |
| "pageElement":"//div[@class='mod-shoppingContents_item']", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":30716 | |
| }, | |
| { | |
| "url":"^http://full-count\\.jp/.+", | |
| "pageElement":"//div[@class='nextpage']/preceding-sibling::*|//div[@class='under_column_contents_text'][not(//div/@class='nextpage')]/*|//div[@class='top_contents_box']", | |
| "nextLink":"//a[../@class='nextpage' or @rel='next']", | |
| "wedata.net.id":74694 | |
| }, | |
| { | |
| "url":"^http://info\\.b-ch\\.com/", | |
| "pageElement":"//div[@class=\"blog\"]", | |
| "nextLink":"//div[@class=\"navi\"]/a[contains(text(), \"TOP\")]/preceding-sibling::a[contains(text(), \"<<\")] | //div[@class=\"navi\"]/a[contains(text(), \">>\")]", | |
| "wedata.net.id":63930 | |
| }, | |
| { | |
| "url":"^http://www\\.soso\\.com/q", | |
| "pageElement":"//div[@class='results']/*", | |
| "nextLink":"id('sogou_next')", | |
| "wedata.net.id":64747 | |
| }, | |
| { | |
| "url":"^http://customize\\.org/.+", | |
| "pageElement":"id('content')/div[not(@style)]|id('messages-table')//tr[not(@class)]|//table[@class='table'][not(tbody/tr/td[h1 or h2 or div/@class='paginator'])]/tbody/tr[td]", | |
| "nextLink":"//a[.='Next »' or .='Older »']", | |
| "wedata.net.id":77598 | |
| }, | |
| { | |
| "url":"^http://vi\\.sualize\\.us/", | |
| "pageElement":"id('container')", | |
| "nextLink":"//a[starts-with(@class,'next btn ')]", | |
| "wedata.net.id":689 | |
| }, | |
| { | |
| "url":"^http://www\\.afpbb\\.com/", | |
| "pageElement":"//section[contains(@class,\"article-list\")]//li", | |
| "nextLink":"//li[@class=\"next\"]/a|//li[./a[contains(@class,\"current\")]]/following-sibling::li[1]/a", | |
| "wedata.net.id":64722 | |
| }, | |
| { | |
| "url":"^https?://careerpark\\.jp/", | |
| "pageElement":"//ul[@class=\"article-list--large\"]/li", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":76475 | |
| }, | |
| { | |
| "url":"^http://whatculture\\.com/", | |
| "pageElement":"(//div[@class='entry']|id('latest-updates'))/article", | |
| "nextLink":"//a[.//@class='btn' or strong='Older']", | |
| "wedata.net.id":74698 | |
| }, | |
| { | |
| "url":"^http://www\\.webmd\\.com/", | |
| "pageElement":"//div[@class='article-content']/section/*[not(contains(.,'continued...'))]|id('textArea')/h2[1]/following-sibling::*[not(@class='subhead_fmt' or starts-with(@class,'in-article-nav') or self::h3[contains(.,'continued...')])]", | |
| "nextLink":"//a[@class='icon-arrow-right' or ../@class='outline_fmt right']", | |
| "wedata.net.id":29229 | |
| }, | |
| { | |
| "url":"^http://www\\.iherb\\.com/", | |
| "pageElement":"//div[@class='panel']/article", | |
| "nextLink":"//div[@class='pagination']/span[@style]/following-sibling::a[1]", | |
| "wedata.net.id":36089 | |
| }, | |
| { | |
| "url":"^http://video\\.fc2\\.com/", | |
| "pageElement":"id(\"video_list_4column video_list_2column video_list_1column\")|//div[@class=\"member_prof_box clearfix\" or @class=\"ch_movie_list_wrap clearfix\"]", | |
| "nextLink":"//div[@class='pager_box']/strong/following-sibling::a[1]", | |
| "wedata.net.id":76476 | |
| }, | |
| { | |
| "url":"^http://togetter\\.com/li/", | |
| "pageElement":"//li[@class='list_item']", | |
| "nextLink":"//link[@rel='next']", | |
| "wedata.net.id":62666 | |
| }, | |
| { | |
| "url":"^http://www\\.kanshu\\.la/", | |
| "pageElement":"id('contentTxt')", | |
| "nextLink":"id('a_03')", | |
| "wedata.net.id":77687 | |
| }, | |
| { | |
| "url":"^http://www\\.00ksw\\.com/", | |
| "pageElement":"id('content')", | |
| "nextLink":"//div[@class='bottem2']/a[not(@onclick)][last()]", | |
| "wedata.net.id":77686 | |
| }, | |
| { | |
| "url":"^http://csqa\\.kddi\\.com/", | |
| "pageElement":"//table[@class='questions']//tr", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":60492 | |
| }, | |
| { | |
| "url":"^http://tako3\\.com/recent", | |
| "pageElement":"//*[self::ul or self::p[contains(text(),\"ago\")]]", | |
| "nextLink":"//body/p[last()]/a[last()]", | |
| "wedata.net.id":60785 | |
| }, | |
| { | |
| "url":"^http://blog\\.pahko\\.jp/", | |
| "pageElement":"id(\"mainBox\")/div", | |
| "nextLink":"id(\"mainBox\")/p[@class=\"nextNews\"]/a", | |
| "wedata.net.id":54420 | |
| }, | |
| { | |
| "url":"^http://memori\\.qip\\.ru/", | |
| "pageElement":"id('bookmarks')/ul/li", | |
| "nextLink":"//div[@class='pagenav fl']/b/following-sibling::a[1]", | |
| "wedata.net.id":1957 | |
| }, | |
| { | |
| "url":"^http://madamenoire\\.com/", | |
| "pageElement":"id('post_content')", | |
| "nextLink":"//ul[@class='pages']/li/following-sibling::a", | |
| "wedata.net.id":76926 | |
| }, | |
| { | |
| "url":"^https?://softarchive\\.la", | |
| "pageElement":"//ul[@class='main_items_list clear']/li", | |
| "nextLink":"//li[@class='next_page']/a", | |
| "wedata.net.id":74969 | |
| }, | |
| { | |
| "url":"^http://xxeronetxx\\.info/", | |
| "pageElement":"id('leftcolumn')//div[@class='blueBox' or @class='blueBoxImg']", | |
| "nextLink":"//a[@title='次頁へ移動する']", | |
| "wedata.net.id":70123 | |
| }, | |
| { | |
| "url":"^https?://pdmagazine\\.jp/", | |
| "pageElement":"//div[contains(@class,'letter_body')]/*", | |
| "nextLink":"//div[@class='page-links']/span/following-sibling::a", | |
| "wedata.net.id":80703 | |
| }, | |
| { | |
| "url":"^http://extendopera\\.org/", | |
| "pageElement":"//div[@class=\"view-content\"]//tr[./td]", | |
| "nextLink":"//li[@class=\"pager-next\"]/a", | |
| "wedata.net.id":30952 | |
| }, | |
| { | |
| "url":"^http://www\\.eweek\\.com/", | |
| "pageElement":"//div[@class='article_body']/node()[not(//@class='slideshow_list')]|//div[@class='archive_container']/ul|//div[@class='blog__listing_pagination']/preceding-sibling::*[//div/@class='slideshow_list']", | |
| "nextLink":"//a[.='Next' or .='>']", | |
| "wedata.net.id":32392 | |
| }, | |
| { | |
| "url":"^http://blog\\.kusfa\\.jp/", | |
| "pageElement":"id(\"content\")/div[@class=\"blog\" or @id=\"trackback\" or @class=\"trackback-body\" or @id=\"comments\"]", | |
| "nextLink":"//table[starts-with(@class,\"navi-\")]//td[@class=\"pager-off\"][span[number(.)>0]]/following-sibling::td/a|//td[@class=\"prev-article-on\"]/a|id(\"content\")/div[@class=\"navi\"]/a[.=\"TOP\"]/preceding-sibling::a[1]|id(\"content\")/div[@class=\"navi\"]/text()[(contains(.,\"1\") and string-length(.)>3) or number(normalize-space(translate(.,\"-.\",\"\")))>0]/following-sibling::a", | |
| "wedata.net.id":61306 | |
| }, | |
| { | |
| "url":"^http://www\\.spike\\.com/", | |
| "pageElement":"//div[@class='middle'][p]", | |
| "nextLink":"//a[(text()='Next')]", | |
| "wedata.net.id":2851 | |
| }, | |
| { | |
| "url":"^http://.+\\.newhua\\.com/", | |
| "pageElement":"//div[@class='body_article']", | |
| "nextLink":"//a[@class='thisclass']/following-sibling::a[1][starts-with(@href,'http://')]", | |
| "wedata.net.id":76654 | |
| }, | |
| { | |
| "url":"^http://www\\.pcper\\.com/", | |
| "pageElement":"id('EchoTopic')[//li/@class='pager-current']|(//div[@class='review-content']/h4|//div[@id='EchoTopic']/*[following-sibling::div/@id='book-navigation-'])[//div/@id='book-navigation-']", | |
| "nextLink":"//a[@class='page-next' or ../@class='pager-next last']", | |
| "wedata.net.id":76681 | |
| }, | |
| { | |
| "url":"^http://www\\.lifed\\.com/", | |
| "pageElement":"//div[@class='thecontent']", | |
| "nextLink":"//a[@class='pagination--next']", | |
| "wedata.net.id":79987 | |
| }, | |
| { | |
| "url":"^http://.+\\.people\\.com/", | |
| "pageElement":"//div[@class='news-item' or @class='toutSection ' or (@class='tout' and parent::div/@id='toutList') or (starts-with(@class,'blogEntry') and not(starts-with(@id,'adLeft')))]", | |
| "nextLink":"//li[@class='nav-next' or @class='next' or @class='nextPost']/a", | |
| "wedata.net.id":74942 | |
| }, | |
| { | |
| "url":"^http://www\\.cosmiq\\.de/", | |
| "pageElement":"//ul[@class='resultList']/li", | |
| "nextLink":"id('pageList')/li[starts-with(@class,'active')]/following-sibling::li[1]/a", | |
| "wedata.net.id":31212 | |
| }, | |
| { | |
| "url":"^http://tr\\.twipple\\.jp/", | |
| "pageElement":"//div[@class=\"header-area\"]/div[contains(@class,\"sc2\")]", | |
| "nextLink":"//div[@class=\"pageArea\"]/a[contains(@class,\"page_on\")]/following-sibling::a[1]", | |
| "wedata.net.id":76863 | |
| }, | |
| { | |
| "url":"^http://arstechnica\\.com/", | |
| "pageElement":"id('content')/section/ol/li | //*[@id=\"article-guts\"]/div[1] | //article/header", | |
| "nextLink":"//td[@class='subheading older']/a | //a[span/@class='next']", | |
| "wedata.net.id":1747 | |
| }, | |
| { | |
| "url":"^http://zigsow\\.jp/portal", | |
| "pageElement":"id('zigsow-item-list')/tbody|//div[@class='review-list featured-review-list']/ul/li", | |
| "nextLink":"//li[@class='selected-page' or @class='active']/following-sibling::li/a", | |
| "wedata.net.id":1762 | |
| }, | |
| { | |
| "url":"^http://shokenro\\.jp/\\d+", | |
| "pageElement":"id(\"center\")/*", | |
| "nextLink":"//div[contains(concat(\" \", @class, \" \"), \" book-contents-pagelink-left \")]/a", | |
| "wedata.net.id":55499 | |
| }, | |
| { | |
| "url":"^http://up\\.subuya\\.com/", | |
| "pageElement":"//form[@method=\"POST\" and @action=\"siokara.php\"]/hr[last()]/preceding-sibling::node()", | |
| "nextLink":"//tr/td/b/following-sibling::a[1]", | |
| "wedata.net.id":39703 | |
| }, | |
| { | |
| "url":"^http://(?:[^.]+.)?nnm.me/", | |
| "pageElement":"//div[@class=\"article\"]|//div[@class=\"tags\"]|//div[@class=\"article-meta clearfix\"]", | |
| "nextLink":"//span[@class=\"next\"]/a", | |
| "wedata.net.id":31618 | |
| }, | |
| { | |
| "url":"^http://perezhilton\\.com/", | |
| "pageElement":"id('left')//div[starts-with(@id,'post-') or @class='gallerybox']", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":74840 | |
| }, | |
| { | |
| "url":"^http://ae-users\\.com/jp/", | |
| "pageElement":"id(\"primarycontent\")/div[contains(concat(\" \", @class, \" \"), \" hentry \")]", | |
| "nextLink":"id(\"primarycontent\")/div[contains(concat(\" \", @class, \" \"), \" navigation \")]/div[@class=\"left\"]/a", | |
| "wedata.net.id":27877 | |
| }, | |
| { | |
| "url":"^http://www\\.bepal\\.net/", | |
| "pageElement":"//ul[@class=\"modListPost\"]/li|//section[@class=\"modWysiwyg\"]", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":80916 | |
| }, | |
| { | |
| "url":"^http://polycount\\.com/.+", | |
| "pageElement":"//table[@class='DataTable DiscussionsTable']/tbody/tr|(//ul[starts-with(@class,'MessageList')]|id('search-results'))/li", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":61651 | |
| }, | |
| { | |
| "url":"^http://www\\.jprime\\.jp/", | |
| "pageElement":"//div[@class=\"page-links\"]/preceding-sibling::*", | |
| "nextLink":"//div[@class=\"page-links\"]/span/following-sibling::a[1]", | |
| "wedata.net.id":80872 | |
| }, | |
| { | |
| "url":"^https?://www\\.ted\\.com/", | |
| "pageElement":"//div[contains(concat(' ', @class, ' '), ' row ')]/div[@class='col' and not(button or input)]", | |
| "nextLink":"//div[contains(concat(' ', @class, ' '), ' pagination ')]//a[@rel='next']", | |
| "wedata.net.id":66805 | |
| }, | |
| { | |
| "url":"^http://dot\\.asahi\\.com/", | |
| "pageElement":"id(\"pg\")/preceding-sibling::p/text()[string-length()>\"1\"]|id(\"pg\")/preceding-sibling::p/text()[string-length()>\"1\"]/following-sibling::br", | |
| "nextLink":"//link[@rel=\"next\"]", | |
| "wedata.net.id":74897 | |
| }, | |
| { | |
| "url":"^http://radioupdate\\.net/", | |
| "pageElement":"id('list')/div|//p[@class='post-meta'][//h1/@class='entry-title']|id('the-content')/node()[not(@class='widget pc_text' or @class='sns-group sns-group-bottom' or self::h5 or audio)]|//h1[@class='entry-title']", | |
| "nextLink":"//a[../@class='next' or @rel='prev']", | |
| "wedata.net.id":77248 | |
| }, | |
| { | |
| "url":"^http://www\\.asahi\\.com/", | |
| "pageElement":"//div[@class='BodyTxt']/*", | |
| "nextLink":"//p[@class='Next']/a", | |
| "wedata.net.id":80670 | |
| }, | |
| { | |
| "url":"^http://www\\.macbed\\.com", | |
| "pageElement":"//li[@class='post clearfix']", | |
| "nextLink":"//a[@class='next page-numbers']", | |
| "wedata.net.id":55295 | |
| }, | |
| { | |
| "url":"^https?://archive\\.today/", | |
| "pageElement":"id('CONTENT')/div[1]/following-sibling::div", | |
| "nextLink":"id('next')", | |
| "wedata.net.id":74886 | |
| }, | |
| { | |
| "url":"^http://alllossless\\.net/", | |
| "pageElement":"//div[contains(concat(' ', @class, ' '), ' post-story ')]", | |
| "nextLink":"//div[contains(concat(' ', @class, ' '), ' navigation ')]/a[.='Далее']", | |
| "wedata.net.id":62045 | |
| }, | |
| { | |
| "url":"^http://biz-journal\\.jp/*", | |
| "pageElement":"id(\"bjLatest\")/div[@class=\"bjCategorySmall\" or @id=\"bjLatestLarge\"]|//div[@class=\"entryBody\"]", | |
| "nextLink":"//link[@rel=\"next\"]", | |
| "wedata.net.id":62041 | |
| }, | |
| { | |
| "url":"^http://www\\.as-web\\.jp/", | |
| "pageElement":"//div[@class='item-text']/*|//ul[@class='ul-news-list']/li", | |
| "nextLink":"//link[@rel='next']", | |
| "wedata.net.id":80571 | |
| }, | |
| { | |
| "url":"^http://info\\.jugem\\.jp/", | |
| "pageElement":"//div[@class=\"Entry\"]", | |
| "nextLink":"id(\"PageNaviNext\")/a", | |
| "wedata.net.id":80657 | |
| }, | |
| { | |
| "url":"^http://www\\.emsodm\\.com", | |
| "pageElement":"id('Display_News')/div[contains(@id,'ysco')]", | |
| "nextLink":"//a[contains(img/@src,'/next.gif')]", | |
| "wedata.net.id":66858 | |
| }, | |
| { | |
| "url":"^http://www\\.zimuzu\\.tv/", | |
| "pageElement":"//*[@class='resource-showlist' or @class='user-favlist' or @class='box subtitle-list' or @class='article-list']//li", | |
| "nextLink":"//a[contains(.,'下一页')]", | |
| "wedata.net.id":73773 | |
| }, | |
| { | |
| "url":"^https?://hitosara\\.com/", | |
| "pageElement":"//div[@class='shop_bg']/*", | |
| "nextLink":"//span[@class='current']/following-sibling::a[1]", | |
| "wedata.net.id":64616 | |
| }, | |
| { | |
| "url":"^https?://.*/search\\.php", | |
| "pageElement":"(id('page-body')|//div[@class='page-content'])/div[contains(@class,'post bg')]|//ul[@class='topiclist topics']|//table[@class='forumline']/tbody/tr[td[contains(@class,'row') or @class='catHead']]|//form//table[@class='tablebg']/tbody/tr[td/@class='row1' or @class='row1' or @class='row2' or td/@class='row3h' or @class='spacer']|//form[@id='inlinemodform']/table[starts-with(@id,'post')]|//table[starts-with(@id,'threadslist')]/tbody/tr[contains(td/@id,'td_threadtitle')]|//ol[@id='searchbits']|//tbody[tr/td/@class='tcl']", | |
| "nextLink":"//a[@rel='next']|//div[contains(@class,'pagination') or contains(@class,'nav')]//strong/following-sibling::a[1]", | |
| "wedata.net.id":39059 | |
| }, | |
| { | |
| "url":"^http://lifehacking\\.jp/", | |
| "pageElement":"//ul[@class=\"content\"]/li|//div[@class=\"content-col col-main\"]/*[@class=\"breadcrumbs single-breadcrumbs\" or self::article]", | |
| "nextLink":"//a[@rel=\"prev\"]|//div[@class=\"widget-content\"]//li[./a[@href=//link[@rel=\"canonical\"]/@href]]/following-sibling::li[1]/a", | |
| "wedata.net.id":1847 | |
| }, | |
| { | |
| "url":"^http://castalbums\\.org/", | |
| "pageElement":"id('cr-site-container')//tbody/tr|//div[@class='col-md-9']/*[self::h3 or @class='btn-toolbar' or @class='row']", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":76735 | |
| }, | |
| { | |
| "url":"^http://carp\\.ho2\\.info", | |
| "pageElement":"id('content')/article", | |
| "nextLink":"//link[@rel=\"next\"]|//a[@rel=\"prev\"][not(//link[@rel=\"next\"])]", | |
| "wedata.net.id":80877 | |
| }, | |
| { | |
| "url":"^http://iteenvideo\\.com/", | |
| "pageElement":"id(\"t_block_2\")", | |
| "nextLink":"id(\"page_num\")/span[not(@class)]/following-sibling::a[1]", | |
| "wedata.net.id":39306 | |
| }, | |
| { | |
| "url":"^http://apachan\\.net/all", | |
| "pageElement":"//center[./font]/following-sibling::hr[1]/following-sibling::*[self::table or self::br][./following-sibling::hr]", | |
| "nextLink":"//center/font/following-sibling::a", | |
| "wedata.net.id":76723 | |
| }, | |
| { | |
| "url":"^http://li2\\.zouri\\.jp/", | |
| "pageElement":"id(\"main\")", | |
| "nextLink":"id(\"right\")//a[2]", | |
| "wedata.net.id":74859 | |
| }, | |
| { | |
| "url":"^http://www\\.alluc\\.ee/", | |
| "pageElement":"//div[@class='resblock']", | |
| "nextLink":"//a[.='Next']", | |
| "wedata.net.id":76768 | |
| }, | |
| { | |
| "url":"^http://yomimonoweb\\.jp/", | |
| "pageElement":"//div[@class='story']/*[not(@class='pnav')]", | |
| "nextLink":"//p[@class='np']/a", | |
| "wedata.net.id":67097 | |
| }, | |
| { | |
| "url":"^http://jerog\\.com/main/", | |
| "pageElement":"//div[@class=\"box\"]/*", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":55417 | |
| }, | |
| { | |
| "url":"^http://pornsharia\\.com/", | |
| "pageElement":"//div[contains(concat(' ', @class, ' '), ' rwrap ')]/div", | |
| "nextLink":"//div[contains(concat(' ', @class, ' '), ' rpages ')]/span/following-sibling::a[1]", | |
| "wedata.net.id":62052 | |
| }, | |
| { | |
| "url":"^http://www.mikrolisk.de/", | |
| "pageElement":"//thead/following-sibling::tbody/tr[td/b/text()]", | |
| "nextLink":"//font[@style='color: #FFA500; font-weight: bold; font-size: 14pt;']/following-sibling::a[1]", | |
| "wedata.net.id":66693 | |
| }, | |
| { | |
| "url":"^http://www\\.wykop\\.pl/", | |
| "pageElement":"id('itemsStream')/*", | |
| "nextLink":"//a[.='następna']", | |
| "wedata.net.id":67302 | |
| }, | |
| { | |
| "url":"^http://find-travel\\.jp/", | |
| "pageElement":"//div[@class=\"article cfix\"]", | |
| "nextLink":"//li[@class=\"next\"]/a", | |
| "wedata.net.id":76696 | |
| }, | |
| { | |
| "url":"^http://pornenergy\\.net/", | |
| "pageElement":"//tr[td[contains(concat(' ', @class, ' '), ' article_column ')]]", | |
| "nextLink":"//ul[contains(concat(' ', @class, ' '), ' pagination ')]/li[span[not(a)]]/following-sibling::li[1]//a", | |
| "wedata.net.id":62053 | |
| }, | |
| { | |
| "url":"^http://javarchive\\.com/", | |
| "pageElement":"//div[@id='post-entry']", | |
| "nextLink":"//a[strong='»']", | |
| "wedata.net.id":66463 | |
| }, | |
| { | |
| "url":"^http://e-shuushuu\\.net/", | |
| "pageElement":"id('content')/div[contains(concat(' ', @class, ' '), ' image_thread ') or contains(concat(' ', @class, ' '), ' thumbview ')]/* | id('tag_list')/*", | |
| "nextLink":"id('content')/div[contains(concat(' ', @class, ' '), ' pagination ')]/ul/li/a[contains(., 'Next')]", | |
| "wedata.net.id":32054 | |
| }, | |
| { | |
| "url":"^http://v2ex\\.com/recent", | |
| "pageElement":"//div[@class='cell item']", | |
| "nextLink":"//link[@rel='next']", | |
| "wedata.net.id":76868 | |
| }, | |
| { | |
| "url":"^http://(.+)\\.asks\\.jp/", | |
| "pageElement":"//ul/center/following-sibling::table|//center[.//table]", | |
| "nextLink":"//center/a[1]|//p//a[contains(@href,number(substring-before(//p//i/b/text(),'...'))-1)]", | |
| "wedata.net.id":76693 | |
| }, | |
| { | |
| "url":"^http://iconmonstr\\.com/", | |
| "pageElement":"//div[@class='container-content-items']/*", | |
| "nextLink":"//span[@class='page-numbers current']/following-sibling::a[1]", | |
| "wedata.net.id":62404 | |
| }, | |
| { | |
| "url":"^http://hiro\\.asks\\.jp/", | |
| "pageElement":"id('sadrzaj')/div[@class='lijeva_rubrika']/*[preceding-sibling::p[2]][following-sibling::p[last()]]", | |
| "nextLink":"//p/a[contains(@href,\"?skip\")][1]", | |
| "wedata.net.id":76691 | |
| }, | |
| { | |
| "url":"^http://techreport\\.com/", | |
| "pageElement":"//div[@class=\"normal\"]", | |
| "nextLink":"//a[@class=\"next\"]", | |
| "wedata.net.id":1894 | |
| }, | |
| { | |
| "url":"^http://www\\.23wx\\.com/", | |
| "pageElement":"id(\"contents\")/node()|//h1", | |
| "nextLink":"id(\"footlink\")/a[last()][not(@href=\"index.html\")]", | |
| "wedata.net.id":80933 | |
| }, | |
| { | |
| "url":"^http://apkfullpro\\.net/", | |
| "pageElement":"//div[@class='uk-grid']", | |
| "nextLink":"//a[i/@class='uk-icon-double-angle-right']", | |
| "wedata.net.id":76889 | |
| }, | |
| { | |
| "url":"^http://www\\.bnrq\\.com/", | |
| "pageElement":"id(\"content\")/node()|//div[@class=\"bookname\"]", | |
| "nextLink":"//div[@class='bottem2']/a[4]", | |
| "wedata.net.id":80934 | |
| }, | |
| { | |
| "url":"^https://i\\.lumine\\.jp/", | |
| "pageElement":"id('itemResultList')/*|//div[@class='resultList']/*", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":64182 | |
| }, | |
| { | |
| "url":"^http://www\\.cfwx\\.net/", | |
| "pageElement":"id(\"contents\")/node()|//h1", | |
| "nextLink":"id(\"footlink\")/a[last()][contains(@href,\".html\")]", | |
| "wedata.net.id":80938 | |
| }, | |
| { | |
| "url":"^http://2ch-matome\\.com/", | |
| "pageElement":"id('mainTable')//tr", | |
| "nextLink":"id(\"m-f-link\")/a[last()][not(contains(@href,\"/101\"))]", | |
| "wedata.net.id":64059 | |
| }, | |
| { | |
| "url":"^http://gameganba\\.com/.", | |
| "pageElement":"//div[starts-with(@id,'post-')]", | |
| "nextLink":"//a[@class='next_link']", | |
| "wedata.net.id":74964 | |
| }, | |
| { | |
| "url":"^http://www\\.qetic\\.jp/", | |
| "pageElement":"//div[@class='single_content']/node()", | |
| "nextLink":"//div[@class='pagination clearfix']/span[@class='c-page']/following-sibling::a[1]", | |
| "wedata.net.id":74966 | |
| }, | |
| { | |
| "url":"^http://youravhost\\.net/", | |
| "pageElement":"//div[@class=\"list-entry\"]", | |
| "nextLink":"//link[@rel=\"next\"]", | |
| "wedata.net.id":36973 | |
| }, | |
| { | |
| "url":"^http://.*\\.about\\.com/", | |
| "pageElement":"//div[@class='res']|//article/*[preceding-sibling::div/@class='published']", | |
| "nextLink":"//span[@class='cp']/following-sibling::a[1]|//a[@class='btn next btn-light']", | |
| "wedata.net.id":32420 | |
| }, | |
| { | |
| "url":"^http://blog\\.ngsw\\.jp/", | |
| "pageElement":"//h2[@class=\"article_title\"]", | |
| "nextLink":"//p[@class=\"pagelink__next\"]/a", | |
| "wedata.net.id":79963 | |
| }, | |
| { | |
| "url":"^https://rpgmaker\\.net/.", | |
| "pageElement":"id('body')//*[td[not(ancestor::div/@class='right_column')] or starts-with(@class,'contents message')]", | |
| "nextLink":"//a[.='next']", | |
| "wedata.net.id":74972 | |
| }, | |
| { | |
| "url":"^http://trafficnews\\.jp/", | |
| "pageElement":"id('detail')/*[self::h2 or self::p or self::figure or @id='writer-profile']|//ul[@class='archive-list']/li", | |
| "nextLink":"//div[contains(@class,'pag')][contains(@class,'nation')]/span[last()]/following-sibling::a", | |
| "wedata.net.id":76950 | |
| }, | |
| { | |
| "url":"^http://ototoy\\.jp/news/", | |
| "pageElement":"//div[@class=\"post_footer\"]/preceding-sibling::*", | |
| "nextLink":"//div[contains(@style,\"text-align:center\")]/span/span[last()][count(./a)=1]/a", | |
| "wedata.net.id":77296 | |
| }, | |
| { | |
| "url":"^http://aoimania\\.com/.*", | |
| "pageElement":"//div[contains(@class, 'contentInner')]/ul[not(@class='paging')]", | |
| "nextLink":"//ul[@class=\"paging\"]/li/a[contains(text(), \"次へ\")]", | |
| "wedata.net.id":76482 | |
| }, | |
| { | |
| "url":"^http://biz\\.icxo\\.com/", | |
| "pageElement":"//font[@class='font141']", | |
| "nextLink":"//p[@align=\"center\"]//a[last()]", | |
| "wedata.net.id":76958 | |
| }, | |
| { | |
| "url":"^http://narou\\.dip\\.jp/", | |
| "pageElement":"//div[@class=\"kensaku\"]/following-sibling::*[following-sibling::div[@class=\"kensaku\"]]", | |
| "nextLink":"//div[@class=\"kensaku\"]/span/following-sibling::a", | |
| "wedata.net.id":80950 | |
| }, | |
| { | |
| "url":"^http://www\\.cyzo\\.com/", | |
| "pageElement":"//div[@class=\"entpagelink\"]/preceding-sibling::node()|id(\"gravure-photo\")|//*[@class=\"entry-date\" or @class=\"entry-title\" or @class=\"entry-d-key\" or @id=\"pankuzu\"][//span[@class=\"current_page\"]/text()=1 or //div[@class=\"entpagelink\"][not(./*)]]", | |
| "nextLink":"//a[@class=\"link_next\"]|//div[contains(@class,\"pagelinkBox\")]/ul/li[1]/a", | |
| "wedata.net.id":60491 | |
| }, | |
| { | |
| "url":"http://syosetu\\.com/bbs/", | |
| "pageElement":"//div[@class='topic_list']", | |
| "nextLink":"//a[@title='next page']", | |
| "wedata.net.id":80710 | |
| }, | |
| { | |
| "url":"^http://studiogeeks\\.co/", | |
| "pageElement":"//p[@class=\"footer-copy\"]", | |
| "nextLink":"id(\"footer-gnav-ul\")/li[last()]/a", | |
| "wedata.net.id":80755 | |
| }, | |
| { | |
| "url":"^http://www\\.ceneo\\.pl/", | |
| "pageElement":"//div[@class='category-list-body js_category-list-body js_search-results']/div", | |
| "nextLink":"//li[@class='page-arrow arrow-next']/a", | |
| "wedata.net.id":32515 | |
| }, | |
| { | |
| "url":"^http://matome-blog\\.jp/", | |
| "pageElement":"id('content')/table//tr[td]", | |
| "nextLink":"//span[@class='current']/following-sibling::a[1]", | |
| "wedata.net.id":55858 | |
| }, | |
| { | |
| "url":"^https?://comicbook.com/.", | |
| "pageElement":"//article[@class='category_art']|//li[@class='entityrank_itm']", | |
| "nextLink":"//a[@class='next_lnk btn grey']", | |
| "wedata.net.id":80958 | |
| }, | |
| { | |
| "url":"^http://jugem\\.jp/theme/", | |
| "pageElement":"id(\"user_theme_page theme_list\")/div[contains(\" user_entry user_theme \",concat(\" \",@class,\" \"))]", | |
| "nextLink":"id(\"user_theme_page theme_list\")/div[contains(concat(\" \",@class,\" \"),\" pager \")]/p/b[u]/following-sibling::a", | |
| "wedata.net.id":54343 | |
| }, | |
| { | |
| "url":"^http://www\\.skins\\.be/", | |
| "pageElement":"//div[@class='motive nof']", | |
| "nextLink":"id('pagination')/span/following-sibling::a[1]", | |
| "wedata.net.id":32516 | |
| }, | |
| { | |
| "url":"^http://www\\.agito\\.pl/", | |
| "pageElement":"id('products-holder')/*[@class='product-holder-grid' or @class='clear' or self::script]", | |
| "nextLink":"//a[span/@class='icon-i44-go-right']", | |
| "wedata.net.id":32523 | |
| }, | |
| { | |
| "url":"^http://www\\.b-ch\\.com/", | |
| "pageElement":"id('archives')/* | id('calendar-navi calendar-day')", | |
| "nextLink":"//dl[@class='ttl-list-menu']/dd/a[contains(.,'≫次の')] | id('calendar-navi')/span/a[contains(','前日<<')]", | |
| "wedata.net.id":63929 | |
| }, | |
| { | |
| "url":"^http://manganikki\\.com/", | |
| "pageElement":"//div[@class='thumbnails recentworks row'][//meta[@property='og:url'][@content='http://manganikki.com/' or contains(@content,'index.php?page=')]]/div|//div[@class='img-set']/*", | |
| "nextLink":"//li[@class='active']/following-sibling::li[1]/a", | |
| "wedata.net.id":80762 | |
| }, | |
| { | |
| "url":"^http://clicccar\\.com/20", | |
| "pageElement":"//div[@class='page-link-box']/preceding-sibling::*", | |
| "nextLink":"//a[(text()='»次ページ')]", | |
| "wedata.net.id":75022 | |
| }, | |
| { | |
| "url":"^http://negineesan\\.com/", | |
| "pageElement":"id(\"content_in\")/p[img]", | |
| "nextLink":"//a[contains(translate(.,\"ENTX\",\"entx\"),\"next\")]", | |
| "wedata.net.id":74683 | |
| }, | |
| { | |
| "url":"^https://pjmedia.com/.+/.", | |
| "pageElement":"//div[@class='pagination']/preceding-sibling::*", | |
| "nextLink":"//a[button/@rel='next']", | |
| "wedata.net.id":80967 | |
| }, | |
| { | |
| "url":"^http://img\\.ly/images/.", | |
| "pageElement":"id(\"image-list-detailed\")/li[contains(concat(\" \", @class, \" \"), \" image-list-item \")]", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":34520 | |
| }, | |
| { | |
| "url":"^http://agrospacia\\.com/", | |
| "pageElement":"//div[@class='section' or @class='photo']", | |
| "nextLink":"id('article_footer')/div[2]/ul/li[@class='selected']/following-sibling::li[1]/a", | |
| "wedata.net.id":72743 | |
| }, | |
| { | |
| "url":"^http://snesmusic\\.org/*", | |
| "pageElement":"id('contContainer')/node()[self::text()[contains(.,':') or contains(.,',')] or self::br[preceding-sibling::br[2] and following-sibling::br[last()-2]] or self::a[not(@class='spcUse')] or self::b or self::img]", | |
| "nextLink":"//a[@class='spcUse' and text()='next->']", | |
| "wedata.net.id":74667 | |
| }, | |
| { | |
| "url":"^http://www\\.zbozi\\.cz/", | |
| "pageElement":"//ul[@class='rows']/li", | |
| "nextLink":"//li[@class='next ng-scope']/a", | |
| "wedata.net.id":55928 | |
| }, | |
| { | |
| "url":"^http://www\\.msfn\\.org/", | |
| "pageElement":"//div[@class='post-row'][article]", | |
| "nextLink":"//a[@class='nextpostslink']", | |
| "wedata.net.id":32545 | |
| }, | |
| { | |
| "url":"^http://www\\.yelp\\.com/", | |
| "pageElement":"//div[@class='search-results-content']/ul/li", | |
| "nextLink":"//a[contains(@class,'next pagination')]", | |
| "wedata.net.id":29307 | |
| }, | |
| { | |
| "url":"^https?://bookwalker\\.jp", | |
| "pageElement":"//section[@class=\"row clearfix\"]/*", | |
| "nextLink":"//p[@class=\"pager-next\"]/a", | |
| "wedata.net.id":62754 | |
| }, | |
| { | |
| "url":"^http://alittlepro\\.com/", | |
| "pageElement":"//div[@class='pagination']/preceding-sibling::*", | |
| "nextLink":"//span[@class='current']/following-sibling::a[1]", | |
| "wedata.net.id":77336 | |
| }, | |
| { | |
| "url":"^http://www\\.gtx0\\.com/", | |
| "pageElement":"id('posts')//tr[td/@class='fi-icon fi-box ']", | |
| "nextLink":"//b/a[.='Next Page']", | |
| "wedata.net.id":76228 | |
| }, | |
| { | |
| "url":"^http://stocklogos\\.com/", | |
| "pageElement":"//ul[@class='l-grid']/li|//table[@class='views-table cols-4']/tbody/tr", | |
| "nextLink":"//a[..[@class='more-link' or @class='pager-next']]", | |
| "wedata.net.id":32568 | |
| }, | |
| { | |
| "url":"^http://modernfart\\.jp/2", | |
| "pageElement":"id(\"contentbox\")/div[@class=\"content\"]", | |
| "nextLink":"//div[@class=\"migrationlbox\"]/a", | |
| "wedata.net.id":63107 | |
| }, | |
| { | |
| "url":"^http://wmg\\.jp/special/", | |
| "pageElement":"//*[contains(@class,\"set_disc\")]", | |
| "nextLink":"//a[img[@alt=\"次へ\"]]", | |
| "wedata.net.id":77169 | |
| }, | |
| { | |
| "url":"^http://gonintendo\\.com/", | |
| "pageElement":"//div[@class='content']", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":32583 | |
| }, | |
| { | |
| "url":"^http://mangaonweb\\.com/", | |
| "pageElement":"//div[@class='blog_sort_area mt30']/*", | |
| "nextLink":"id('pager_top')/strong/following-sibling::a[1]", | |
| "wedata.net.id":58797 | |
| }, | |
| { | |
| "url":"^http://www\\.wimp\\.com/", | |
| "pageElement":"id('latest')//div[starts-with(@class,'latest-')][not(//div/@class='story-content')]|id('stories')/*[not(@class='nav-page nav-page-top')]", | |
| "nextLink":"//a[@class='snext' or ../@class='prev-page left']", | |
| "wedata.net.id":77374 | |
| }, | |
| { | |
| "url":"^https?://www.porndex.com", | |
| "pageElement":"//div[@id=\"results\"]/div", | |
| "nextLink":"//a[@class=\"next\"]", | |
| "wedata.net.id":77515 | |
| }, | |
| { | |
| "url":"^http://zozo\\.jp/search/", | |
| "pageElement":"id(\"searchResultList\")", | |
| "nextLink":"//li[contains(concat(\" \", @class, \" \"), \" next \")]/a", | |
| "wedata.net.id":2386 | |
| }, | |
| { | |
| "url":"^http://ninjaslayer\\.jp/", | |
| "pageElement":"//article|id(\"container\")/*", | |
| "nextLink":"//li[@class='current']/following-sibling::li[1]/a|//a[@class=\"browse\"][contains(img/@src,\"next\")]", | |
| "wedata.net.id":63700 | |
| }, | |
| { | |
| "url":"^http://pictogram2\\.com/", | |
| "pageElement":"id('gallery')/ul/li", | |
| "nextLink":"id('wp_page_numbers')/ul/li[@class='active_page']/following-sibling::li/a", | |
| "wedata.net.id":77056 | |
| }, | |
| { | |
| "url":"^http://www\\.hclips.com/", | |
| "pageElement":"//div[@class=\"thumb_holder\"]/a", | |
| "nextLink":"//li[@class=\"next\"]/a", | |
| "wedata.net.id":77377 | |
| }, | |
| { | |
| "url":"^http://taiyohgroup\\.jp/", | |
| "pageElement":"//ul[@class='item-lists_b']/li", | |
| "nextLink":"//a[@class='nextpostslink']", | |
| "wedata.net.id":77729 | |
| }, | |
| { | |
| "url":"^http://appshopper\\.com/", | |
| "pageElement":"//div[@class='section app']", | |
| "nextLink":"//a[@class='btn outlined'][.='Older']", | |
| "wedata.net.id":29439 | |
| }, | |
| { | |
| "url":"^http://www\\.b-boy\\.jp/", | |
| "pageElement":"//p[@class=\"paging\"]/preceding-sibling::*[not(@class=\"pankuzu\" or @class=\"magazineDescription\")]", | |
| "nextLink":"//p[@class=\"paging\"]/a[starts-with(text(), \"<\")]", | |
| "wedata.net.id":63178 | |
| }, | |
| { | |
| "url":"^http://grep\\.cpan\\.me/", | |
| "pageElement":"//div[contains(concat(\" \", @class, \" \"), \" results \")]", | |
| "nextLink":"//div[contains(concat(\" \", @class, \" \"), \" pagination \")]/a[contains(text(), \">>\")]", | |
| "wedata.net.id":45623 | |
| }, | |
| { | |
| "url":"^http://buzzorange\\.com/", | |
| "pageElement":"//footer/preceding-sibling::*", | |
| "nextLink":"//a[@rel='prev']", | |
| "wedata.net.id":74564 | |
| }, | |
| { | |
| "url":"^https://wordpress\\.org/", | |
| "pageElement":"//div[@class=\"col-9\"]/a[1]/preceding-sibling::*", | |
| "nextLink":"//div[@class=\"col-9\"][count(./a)>1 or ./a[@href=\"https://wordpress.org/news/page/2/\"]]/a[last()]", | |
| "wedata.net.id":33482 | |
| }, | |
| { | |
| "url":"^http://railscasts\\.com/", | |
| "pageElement":"//div[@class='episode']", | |
| "nextLink":"//a[@class='next_page']", | |
| "wedata.net.id":73821 | |
| }, | |
| { | |
| "url":"^http://akibahobby\\.net/", | |
| "pageElement":"id(\"main\")/*[contains(concat(\" \",@class,\" \"),\" entry \")]", | |
| "nextLink":"//*[contains(concat(\" \", @class, \" \"), \" current \")]/following-sibling::a", | |
| "wedata.net.id":32744 | |
| }, | |
| { | |
| "url":"^http://www\\.focus\\.de/", | |
| "pageElement":"//div[@class='navigation']/preceding-sibling::*|//div[@class='teaser clearfix']", | |
| "nextLink":"//a[@class='nextPage greyButton' or @class='nextPage browse right']", | |
| "wedata.net.id":32745 | |
| }, | |
| { | |
| "url":"^http://blog\\.ajin\\.jp/", | |
| "pageElement":"//div[@class=\"content\"]/div[@class=\"text\"][1]|//div[@class=\"content\"][not(./div[@class=\"number\"]) or boolean(./div[@class=\"number\"]/span[number()=1])]/*|id(\"main\")/div[@class=\"mcleft\" or @class=\"mc\" or @class=\"clear\"]", | |
| "nextLink":"//div[@class=\"number\"]/span[number()>0]/following-sibling::a|//div[@class=\"number\"]/a[span[@class=\"next\"]]|//table[@class=\"next-previous-link\"]//a[@rel=\"prev\"]|//div[@class=\"wp-pagenavi\"]/span[@class=\"current\"]/following-sibling::a|//ul/li[a[@class=\"currentpage\"]]/following-sibling::li/a", | |
| "wedata.net.id":55981 | |
| }, | |
| { | |
| "url":"^http://p\\.twipple\\.jp/", | |
| "pageElement":"id('rtDet')", | |
| "nextLink":"//a[img/@id='next_icon']", | |
| "wedata.net.id":57320 | |
| }, | |
| { | |
| "url":"^http://seigura\\.com/\\?", | |
| "pageElement":"//div[@class='box_side_news clearfix']", | |
| "nextLink":"//a[@class='page_next']", | |
| "wedata.net.id":63649 | |
| }, | |
| { | |
| "url":"^http://en\\.vpleer\\.ru/", | |
| "pageElement":"//ul[@class='songs-lst']/li", | |
| "nextLink":"//div[@class='pager']/ul/li[@class='active']/following-sibling::li[1]/a", | |
| "wedata.net.id":26948 | |
| }, | |
| { | |
| "url":"^http://cartermatt\\.com/", | |
| "pageElement":"//div[@class='article-list']/div[contains(@class,'post')]", | |
| "nextLink":"//a[@class='next page-numbers']", | |
| "wedata.net.id":77146 | |
| }, | |
| { | |
| "url":"^http://identi\\.ca/group", | |
| "pageElement":"id(\"content_inner\")/ul", | |
| "nextLink":"//li[@class=\"nav_next\"]/a", | |
| "wedata.net.id":26883 | |
| }, | |
| { | |
| "url":"http://www.pornburst.xxx/", | |
| "pageElement":"//div[@class=\"box-link-productora\"]", | |
| "nextLink":"//ul[@class=\"paginador\"]/li[last()]/a", | |
| "wedata.net.id":77747 | |
| }, | |
| { | |
| "url":"^http://pro\\-radio\\.ru/", | |
| "pageElement":"//table[@class='thread-messages']/tbody/tr[td/@class='actor']", | |
| "nextLink":"//span[@class='current-page']/following-sibling::b[1]/a", | |
| "wedata.net.id":77436 | |
| }, | |
| { | |
| "url":"^http://maddawgjav\\.net/", | |
| "pageElement":"id(\"content\")/div[contains(concat(\" \", @class, \" \"), \" post \")]", | |
| "nextLink":"id(\"pagination\")/a[contains(text(), \"\u00bb\")]", | |
| "wedata.net.id":48588 | |
| }, | |
| { | |
| "url":"^http://.+\\.xitek\\.com/", | |
| "pageElement":"//div[@class='column_left_li']", | |
| "nextLink":"//div[@class='yi']/strong/following-sibling::a[1]", | |
| "wedata.net.id":76339 | |
| }, | |
| { | |
| "url":"^https?://manganavi\\.jp/", | |
| "pageElement":"id(\"pager\")/preceding-sibling::*", | |
| "nextLink":"//li[@class=\"here\"]/following-sibling::li[1]/a", | |
| "wedata.net.id":26719 | |
| }, | |
| { | |
| "url":"^http://ohyeah1080\\.com/", | |
| "pageElement":"//div[@class=\"section-header\"]/following-sibling::*[following::ul[@class=\"pagination\"]]", | |
| "nextLink":"//a[@class=\"next page-numbers\"]", | |
| "wedata.net.id":80987 | |
| }, | |
| { | |
| "url":"^http://b\\.pandora\\.nu/", | |
| "pageElement":"id(\"story\")/*", | |
| "nextLink":"id(\"navigation_next\")/a", | |
| "wedata.net.id":33166 | |
| }, | |
| { | |
| "url":"^http://www\\.yobt\\.com/", | |
| "pageElement":"//div[contains(concat(' ', @class, ' '), ' thumb ') and following::*/@class[contains(concat(' ', ., ' '), ' paging ')]]", | |
| "nextLink":"//div[contains(concat(' ', @class, ' '), ' paging ') and not(ancestor::*/@id = 'paysites_pagination')]//a[contains(concat(' ', @class, ' '), ' paging-next ')]", | |
| "wedata.net.id":57171 | |
| }, | |
| { | |
| "url":"^http://uberhavoc\\.com/.", | |
| "pageElement":"//div[@class='pagination-slideshow']/preceding-sibling::*[not(@class='banner' or @class='textwidget')]", | |
| "nextLink":"//a[span/@class='next-btn']", | |
| "wedata.net.id":80808 | |
| }, | |
| { | |
| "url":"^http://find\\.2ch\\.net/", | |
| "pageElement":"//div[@class='box']", | |
| "nextLink":"//a[span/@class='glyphicon glyphicon-chevron-right']", | |
| "wedata.net.id":403 | |
| }, | |
| { | |
| "url":"^http://www\\.xtube\\.com", | |
| "pageElement":"//section[@class=\"Panel space\"] |//*[@class=\"content\"]/div | //div[@class=\"container\"]/table/tbody/tr/td/table/tbody/tr", | |
| "nextLink":"//a[@class=\"Pager__next\"]", | |
| "wedata.net.id":48024 | |
| }, | |
| { | |
| "url":"^https?://filmarks\\.com/", | |
| "pageElement":"//div[div/@class='body']", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":76883 | |
| }, | |
| { | |
| "url":"^http://www.dclog.jp/ai/", | |
| "pageElement":"//div[@id=\"entry-container\"]", | |
| "nextLink":"//a[@accesskey=\"3\"]", | |
| "wedata.net.id":74230 | |
| }, | |
| { | |
| "url":"^http://bato\\.to/reader", | |
| "pageElement":"id('comic_wrap')/div/a", | |
| "nextLink":"//a[img/@title='Next Page']", | |
| "wedata.net.id":76283 | |
| }, | |
| { | |
| "url":"^http://mangajet\\.info/", | |
| "pageElement":"//section[@class=\"text-center view-chapter\"]|//div[@class=\"comic-list\"]/div[1]", | |
| "nextLink":"//div/a[.=\"Next Chapter →\"]|//li/a[.=\"→\"]", | |
| "wedata.net.id":80764 | |
| }, | |
| { | |
| "url":"^http://ptm-net\\.com/20", | |
| "pageElement":"id(\"main\")/article[@class=\"post\"]", | |
| "nextLink":"//link[@rel=\"prev\"]", | |
| "wedata.net.id":77753 | |
| }, | |
| { | |
| "url":"^http://bookmeter.com/.*", | |
| "pageElement":"id('content')", | |
| "nextLink":"//a[(text()=\"次へ\")]", | |
| "wedata.net.id":80991 | |
| }, | |
| { | |
| "url":"http://(www\\.)?di.se/.*", | |
| "pageElement":"//div[@class='tabsbox']", | |
| "nextLink":"//a[@class='next'][1]", | |
| "wedata.net.id":77532 | |
| }, | |
| { | |
| "url":"^http://kojimajan\\.com/", | |
| "pageElement":"id('center_contents single_box')/*[not(self::img)]", | |
| "nextLink":"//a[@class='next page-numbers' or @rel='next' or ../@class='prepost']", | |
| "wedata.net.id":56602 | |
| }, | |
| { | |
| "url":"^http://news\\.aol\\.jp/", | |
| "pageElement":"//div[@class=\"list-imgSurrogate\"]/div[not(@class=\"pagination\")]", | |
| "nextLink":"//li[contains(@class,\"next\")]/a", | |
| "wedata.net.id":77744 | |
| }, | |
| { | |
| "url":"^http://2kporns4u\\.com/", | |
| "pageElement":"//div[@class=\"section-header\"]/following-sibling::*[following::ul[@class=\"pagination\"]]", | |
| "nextLink":"//a[@class=\"next page-numbers\"]", | |
| "wedata.net.id":80984 | |
| }, | |
| { | |
| "url":"^https://macstack\\.net/", | |
| "pageElement":"id('topiclist')//tr[td]|//div[@class='autopagerize']", | |
| "nextLink":"//a[@class='nextpage']", | |
| "wedata.net.id":34631 | |
| }, | |
| { | |
| "url":"^http://xvideo-jp\\.com/", | |
| "pageElement":"id(\"content\")/div/h2|id(\"content\")/div/div[contains(text(),\"年\")]|id(\"content\")/div/p[.//a]|id(\"content\")/div/dl|id(\"content\")/div/div[@class=\"entry-content\"]", | |
| "nextLink":"//*[@id=\"navigation\"]/div/a[@class=\"nextpostslink\"]|//link[@rel=\"next\"]", | |
| "wedata.net.id":65278 | |
| }, | |
| { | |
| "url":"^http://ebten\\.jp/\\w+/", | |
| "pageElement":"//ul[@class='fixHeight']/li", | |
| "nextLink":"//a[@title='次へ']", | |
| "wedata.net.id":56678 | |
| }, | |
| { | |
| "url":"^http://mypornwap\\.com/", | |
| "pageElement":"//div[contains(@class,\"thumbed\")]", | |
| "nextLink":"//a[contains(text(),\"Next\")][not(contains(@href,\"/1001/\"))]", | |
| "wedata.net.id":77495 | |
| }, | |
| { | |
| "url":"^http://6109\\.jp/[^/]+/", | |
| "pageElement":"//div[@class=\"article\"]", | |
| "nextLink":"//div[@class=\"page_foot\"]/a[text()=\"←前の記事\" or contains(text(), \"件→\")]", | |
| "wedata.net.id":65468 | |
| }, | |
| { | |
| "url":"^https://rubygems\\.org/", | |
| "pageElement":"//a[@class='gems__gem']", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":29468 | |
| }, | |
| { | |
| "url":"^http://bookwalker\\.in/", | |
| "pageElement":"//div[@class='newsbox search']/ul", | |
| "nextLink":"//p[@class='pager-next']/a", | |
| "wedata.net.id":77738 | |
| }, | |
| { | |
| "url":"^http://kakaku\\.com/tv/", | |
| "pageElement":"//div[@class=\"w680\"]/*[not(@id=\"navi\")]", | |
| "nextLink":"//a[@class=\"next\" and text()=\"次へ\"]", | |
| "wedata.net.id":29457 | |
| }, | |
| { | |
| "url":"^http://bannch\\.com/bs/", | |
| "pageElement":"id('newslist')//li", | |
| "nextLink":"//ul[@id='linker'][last()][count(./li)>2 or .//a[@href='/bs/BBSnewslist?mode=1&offset=10']]/li[last()]/a", | |
| "wedata.net.id":36105 | |
| }, | |
| { | |
| "url":"^https://townwork\\.net/", | |
| "pageElement":"//div[@class='job-lst-main-cassette-wrap']", | |
| "nextLink":"//div[@class='pager-next-btn']//a", | |
| "wedata.net.id":45553 | |
| }, | |
| { | |
| "url":"^http://mediaqueri\\.es/", | |
| "pageElement":"id(\"content\")/article", | |
| "nextLink":"id(\"pagination\")/a[contains(., \"\u00bb\")]", | |
| "wedata.net.id":57083 | |
| }, | |
| { | |
| "url":"^http://wnyan\\.jp/page/", | |
| "pageElement":"id('main')/div[.//@class='text']", | |
| "nextLink":"//a[.='← Older entries']", | |
| "wedata.net.id":76318 | |
| }, | |
| { | |
| "url":"^http://kob\\.blog\\.jp/", | |
| "pageElement":"//div[@class=\"article-body\" or @class=\"article-header\"]|//ul[@class=\"article-post\"]", | |
| "nextLink":"//li[@class=\"prev\"]/a", | |
| "wedata.net.id":76379 | |
| }, | |
| { | |
| "url":"^http://feedmyapp\\.com/", | |
| "pageElement":"//div[@class='browselist col col-first col-dbl']/div[starts-with(@class,'browseitem')]", | |
| "nextLink":"//a[@title='Next']", | |
| "wedata.net.id":455 | |
| }, | |
| { | |
| "url":"^http://buzzlamp\\.com/.", | |
| "pageElement":"id('content-reload')/*[self::h2 or self::p]", | |
| "nextLink":"id('pageNext')/span/a", | |
| "wedata.net.id":74962 | |
| }, | |
| { | |
| "url":"^http://andronavi\\.com/", | |
| "pageElement":"//div[@id='contents' or @class='cus-bottom' or @class='postSingle__description']|//div[@class='postListSim' or @class='deviceArchive']/a|id('main')/*[starts-with(@class,'appBlock')][div[starts-with(@class,'pageNavi')]]//*[@class='rankingList']//li[@class='rankingList__item']", | |
| "nextLink":"(id('nextpage')|//div[@class='wp-pagenavi'])/a[contains(i/@class,'icon-chevron-right-mobile') or @rel='next']|//span[@class='pageNavi__item pageNavi__item--current']/following-sibling::span[1]/a", | |
| "wedata.net.id":77721 | |
| }, | |
| { | |
| "url":"^http://www\\.cnet\\.com", | |
| "pageElement":"//section[@class='searchItem product']|//div[@class='col-6 fullListing'][last()]/div[@class='row']|//div[@class='asset']|id('editorReview')/*", | |
| "nextLink":"//a[@class='next' and not(id('editorReview')) or @class='load-more ' or @rel='next']", | |
| "wedata.net.id":32725 | |
| }, | |
| { | |
| "url":"^https://logopond\\.com/", | |
| "pageElement":"//li[@class='logo_image']", | |
| "nextLink":"//div[@class=\"pagination\"]/a[1][not(//span[@class=\"current\"])]|//span[@class=\"current\"]/following-sibling::a[1]", | |
| "wedata.net.id":2082 | |
| }, | |
| { | |
| "url":"^http://.+india\\.com/.+", | |
| "pageElement":"//div[starts-with(div/@class,'col-sm-12 col-md-12 mrgn-tp1')]|//div[starts-with(@id,'block-views-list-topic')]//div[@class='media-list ']/div|id('categoryVideos1')/div", | |
| "nextLink":"//a[@class='next_pg' or ..[@class='next' or @class='next last'] or .='»']", | |
| "wedata.net.id":74947 | |
| }, | |
| { | |
| "url":"http://ava.pmang.jp/ne.*", | |
| "pageElement":"table[@class=\"list\"]", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":80959 | |
| }, | |
| { | |
| "url":"^http://filecraft\\.com/", | |
| "pageElement":"//table[contains(concat(' ', @class, ' '), ' search-results ')]", | |
| "nextLink":"id('search_paging')/span[contains(concat(' ', @class, ' '), ' pagenumber ')]/following-sibling::a[1]", | |
| "wedata.net.id":64894 | |
| }, | |
| { | |
| "url":"^http://www\\.mbok\\.jp/", | |
| "pageElement":"//ul[@class='search-list clearfix']/li", | |
| "nextLink":"//span[@class='pnlink_no']/following-sibling::a[1]", | |
| "wedata.net.id":53509 | |
| }, | |
| { | |
| "url":"^http://2-5-d\\.jp/news/", | |
| "pageElement":"//div[@class='NewsList clearfix']", | |
| "nextLink":"//a[@class='next page-numbers']", | |
| "wedata.net.id":65795 | |
| }, | |
| { | |
| "url":"^http://imagechan\\.com/", | |
| "pageElement":"//a[@class='Screen']", | |
| "nextLink":"//li[a/@class='Selected']/following-sibling::li[1]/a", | |
| "wedata.net.id":32721 | |
| }, | |
| { | |
| "url":"^http://imageback\\.com/", | |
| "pageElement":"//div[@class='wrap' or @class='wrsub']/*", | |
| "nextLink":"//span[@class='current']/following-sibling::a[1]", | |
| "wedata.net.id":53516 | |
| }, | |
| { | |
| "url":"^http://.*dilbert\\.com/", | |
| "pageElement":"//img[@class='img-responsive img-comic']|//section/article", | |
| "nextLink":"//div[@class='nav-comic nav-right']/a[//img/@class='img-responsive img-comic']|//div[@class='nav-comic nav-left']/a[//section/article]", | |
| "wedata.net.id":77198 | |
| }, | |
| { | |
| "url":"http://www.digimart.net/", | |
| "pageElement":"//div[@class=\"itemSearchBlock clearfix \"]", | |
| "nextLink":"//li[@class=\"pageCurrent\"]/following-sibling::li/a", | |
| "wedata.net.id":76968 | |
| }, | |
| { | |
| "url":"^http://trendland\\.com/", | |
| "pageElement":"//div[@class=\"small-12 medium-6 large-6 columns\"]", | |
| "nextLink":"//a[@class=\"next page-numbers\"]", | |
| "wedata.net.id":29138 | |
| }, | |
| { | |
| "url":"^https://share.dmhy.org/", | |
| "pageElement":"//div[@class='nav_title']", | |
| "nextLink":"//a[@rel='下一頁']", | |
| "wedata.net.id":80697 | |
| }, | |
| { | |
| "url":"^http://dramanavi\\.net/", | |
| "pageElement":"//div[@class=\"entryBody\"]/p", | |
| "nextLink":"//span[@class=\"nextLink\"]/span/a", | |
| "wedata.net.id":74866 | |
| }, | |
| { | |
| "url":"^http://tabetime\\.com/.", | |
| "pageElement":"//div[@id='main']/div[@class='list']/div[@class='restaurant-summary' or @class='wrap']", | |
| "nextLink":"//a[.='次のページ>']", | |
| "wedata.net.id":2502 | |
| }, | |
| { | |
| "url":"^http://bootsnipp\\.com/", | |
| "pageElement":"//div[@class=\"container\"][last()]/div[@class=\"row\"][1]/div", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":76915 | |
| }, | |
| { | |
| "url":"^http://caplogger\\.com/", | |
| "pageElement":"//div[@class='date' or @class='blogbody' and div/@class='main']", | |
| "nextLink":"//link[@rel='next']", | |
| "wedata.net.id":77853 | |
| }, | |
| { | |
| "url":"^http://moumantai\\.biz/", | |
| "pageElement":"id(\"list-basic\")/*", | |
| "nextLink":"//div[contains(concat(\" \", @class, \" \"), \" page \")]/ul/li[span[contains(concat(\" \", @class, \" \"), \" current-page \")]]/following-sibling::li[1]/a", | |
| "wedata.net.id":58942 | |
| }, | |
| { | |
| "url":"^https?://lowreal\\.net/", | |
| "pageElement":"//div[@class=\"entries\"]", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":515 | |
| }, | |
| { | |
| "url":"^http://xxxbunker\\.com/", | |
| "pageElement":"id(\"listItems\")", | |
| "nextLink":"id(\"videoList\")/table[contains(concat(\" \", @class, \" \"), \" pageLinkStub \")]//a[.=\">\"]", | |
| "wedata.net.id":54298 | |
| }, | |
| { | |
| "url":"^http://musicalbox.ru/.*", | |
| "pageElement":"id(\"center\")/div[@class=\"content\"]/div[@class=\"node clear-block\"]", | |
| "nextLink":"//a[contains(text(), \"следующая ›\")]", | |
| "wedata.net.id":74686 | |
| }, | |
| { | |
| "url":"^http://keep2porn\\.com/", | |
| "pageElement":"//div[@id='dle-content']", | |
| "nextLink":"//div[@id='dle-content']/div[@class='pager']/span[@class='navigation']/span/following-sibling::a", | |
| "wedata.net.id":80824 | |
| }, | |
| { | |
| "url":"^https?://chaturbate.com", | |
| "pageElement":"//ul[@class='list']/li", | |
| "nextLink":"//a[contains(@class,'next')]", | |
| "wedata.net.id":77334 | |
| }, | |
| { | |
| "url":"^http://buzz-plus\\.com/", | |
| "pageElement":"//ul[@class=\"article-list\"]/li", | |
| "nextLink":"//span[@class=\"current\"]/following-sibling::a[1]", | |
| "wedata.net.id":79433 | |
| }, | |
| { | |
| "url":"^http://nikkan-spa\\.jp/", | |
| "pageElement":"//div[@class=\"entryDetailBody\"]/div[@class=\"entryInfo\"][1][not(//div[@class=\"post-pager-box\"]) or //link[@rel=\"canonical\"]/@href=//link[@rel=\"alternate\"][@media=\"handheld\"]/@href]|//div[@class=\"entryInfo\"]/following-sibling::div[@class=\"entryContent\"]/node()[not(@class=\"post-pager-box\")]|//h1[@class=\"entry-title\"][not(//div[@class=\"post-pager-box\"]) or //link[@rel=\"canonical\"]/@href=//link[@rel=\"alternate\"][@media=\"handheld\"]/@href]", | |
| "nextLink":"//div[@class=\"navigation pager\"]/a[@class=\"current\"]/following-sibling::a|//ul[@class=\"pager-ul\"]/li/following-sibling::a|//a[@rel=\"next\"]", | |
| "wedata.net.id":66481 | |
| }, | |
| { | |
| "url":"^http://www\\.tmz\\.com/", | |
| "pageElement":"id('main-content')/article", | |
| "nextLink":"//a[.='NEXT »']", | |
| "wedata.net.id":74725 | |
| }, | |
| { | |
| "url":"^http://ikubon\\.com/wp/", | |
| "pageElement":"//div[@class='entries']", | |
| "nextLink":"//a[@class='ajax-load']|//div[@class='nav-next']/a", | |
| "wedata.net.id":31208 | |
| }, | |
| { | |
| "url":"^http://qvectors\\.net/.", | |
| "pageElement":"id('brushes')/div[starts-with(@class,'item ')]", | |
| "nextLink":"//li[@class='pager-current']/following-sibling::li[1]/a", | |
| "wedata.net.id":32535 | |
| }, | |
| { | |
| "url":"http://.*269g\\.(jp|net)", | |
| "pageElement":"//div[@class=\"blog\"]|//div[@class=\"main-pager\"][not(//div[@class=\"article-list\" or @class=\"articleAreaList\"])]/preceding-sibling::node()|//div[@class=\"article-list\" or @class=\"articleAreaList\"]", | |
| "nextLink":"//div[@class=\"navi\"][last()][//meta[@property=\"og:url\"][contains(@content,\"/article/\")]]/a[1][not(@href=\"http://info.269g.net/\" or @href=\"http://campaign.269g.net/\")]|//div[@class=\"navi\"][last()][not(//meta[@property=\"og:url\"][contains(@content,\"/article/\")])]/a[last()]|//span[@class=\"now-page-num\"]/following-sibling::span[1]/a", | |
| "wedata.net.id":62328 | |
| }, | |
| { | |
| "url":"^http://cnsnews\\.com/.+", | |
| "pageElement":"//div[@class='view-content']/*", | |
| "nextLink":"//li[@class='next last']/a", | |
| "wedata.net.id":77675 | |
| }, | |
| { | |
| "url":"^https://librabuch\\.jp/", | |
| "pageElement":"//div[@class='col m12 l6']", | |
| "nextLink":"//a[contains(@class,'next waves-effect ')]", | |
| "wedata.net.id":79964 | |
| }, | |
| { | |
| "url":"^http://couponsite\\.jp/", | |
| "pageElement":"//ul[@class='dealList']/li", | |
| "nextLink":"//p[@class='pagingNext']/a", | |
| "wedata.net.id":59651 | |
| }, | |
| { | |
| "url":"^http://esoaparte\\.com/", | |
| "pageElement":"//table//tr", | |
| "nextLink":"//p/a[count(//center/following-sibling::p)=1]", | |
| "wedata.net.id":76875 | |
| }, | |
| { | |
| "url":"^http://seexxxnow\\.net/", | |
| "pageElement":"//div[@id='dle-content']", | |
| "nextLink":"//a[img/@src='/templates/seexxxnow/images/spacer.gif' and img/@alt='Вперед']", | |
| "wedata.net.id":80828 | |
| }, | |
| { | |
| "url":"^https://cgcookie\\.com/", | |
| "pageElement":"//div[@class='flex--container']", | |
| "nextLink":"//div[@class='alignright']/a", | |
| "wedata.net.id":62194 | |
| }, | |
| { | |
| "url":"^http://echo-news\\.net/", | |
| "pageElement":"id('single_wrap')", | |
| "nextLink":"//a[@class='nextpostslink']", | |
| "wedata.net.id":74909 | |
| }, | |
| { | |
| "url":"^http://masturbate\\.io/", | |
| "pageElement":"//div[@id=\"page-main\"]//ul[@class='timeline timeline-centered js-timeline clearfix']", | |
| "nextLink":"//div[@id=\"page-main\"]//a[@rel='next']", | |
| "wedata.net.id":76447 | |
| }, | |
| { | |
| "url":"^http://scrapture\\.org/", | |
| "pageElement":"id(\"content\")/div/div[contains(concat(\" \", @class, \" \"), \" pic \")]", | |
| "nextLink":"id(\"pNext\")", | |
| "wedata.net.id":54496 | |
| }, | |
| { | |
| "url":"https://animetosho.org/*", | |
| "pageElement":"//div[@class=\"home_list_datesep\"][1]/following-sibling::div|//div[@class=\"home_list_datesep\"]", | |
| "nextLink":"//a[.='Older Entries >']", | |
| "wedata.net.id":76786 | |
| }, | |
| { | |
| "url":"^http://orgymania\\.net/", | |
| "pageElement":"//td[@width and @valign=\"top\"]/a", | |
| "nextLink":"//a[text()=\"next >\"]", | |
| "wedata.net.id":77634 | |
| }, | |
| { | |
| "url":"^http://sakuhindb\\.com/", | |
| "pageElement":"//table[@class='review_box table']//td[@class='padding_cell']/a[@class='bigbutton button-red']/preceding-sibling::*", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":31673 | |
| }, | |
| { | |
| "url":"^http://boli\\.blog\\.pl", | |
| "pageElement":"//div[@class=\"contentArea\"]/div[@data-postid]", | |
| "nextLink":"//li[@class=\"next\"]/a", | |
| "wedata.net.id":77636 | |
| }, | |
| { | |
| "url":"^https://wornontv\\.net/", | |
| "pageElement":"id('grid')", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":80883 | |
| }, | |
| { | |
| "url":"^http://ranobe-jkt\\.net", | |
| "pageElement":"id(\"copy\")/a[last()]", | |
| "nextLink":"id(\"footernav\")//li[1]/a", | |
| "wedata.net.id":80835 | |
| }, | |
| { | |
| "url":"^http://www\\.lwdf\\.cn/", | |
| "pageElement":"//div[@class='article_left_main']/div[@class='text']/*|//div[@class='content_block']/div[@style]", | |
| "nextLink":"//a[@class='current']/following-sibling::a[@class='normal']", | |
| "wedata.net.id":76766 | |
| }, | |
| { | |
| "url":"^http://matogrosso\\.jp/", | |
| "pageElement":"id(\"alpha-inner\")/*[contains(concat(\" \",@class,\" \"),\" hentry \")]/*[contains(concat(\" \",@class,\" \"),\" entry-content \")]|id(\"brief-footer\")/following-sibling::node()[1]", | |
| "nextLink":"(id(\"backnumberlist pagenavi\")|//div[contains(concat(\" \",@class,\" \"),\" pagenate \")])/ul/li[starts-with(//title/text(), ./a/text()) or span[number(.)>0]]/following-sibling::li/a", | |
| "wedata.net.id":64741 | |
| }, | |
| { | |
| "url":"^https://e621\\.net/post", | |
| "pageElement":"//span[@class=\"thumb\"]", | |
| "nextLink":"//link[@rel=\"next\"]", | |
| "wedata.net.id":67370 | |
| }, | |
| { | |
| "url":"^https?://www.pornbb.org", | |
| "pageElement":"//td[@class=\"bodyline\"]/table[@class=\"forumline\"][2]/tbody/tr[1]/following-sibling::tr", | |
| "nextLink":"//span[@class=\"nav\"]/b/following-sibling::a[1]", | |
| "wedata.net.id":39971 | |
| }, | |
| { | |
| "url":"^https?://nhentai\\.net/", | |
| "pageElement":"id('content')//*[@class='gallery' or @id='image-container']", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":76720 | |
| }, | |
| { | |
| "url":"http://www.foxebook.net/", | |
| "pageElement":"//main/div[starts-with(@class,'row') or starts-with(@class,'col')]", | |
| "nextLink":"//li[@class='active']/following-sibling::li/a", | |
| "wedata.net.id":76704 | |
| }, | |
| { | |
| "url":"^http://www\\.cmoa\\.jp/", | |
| "pageElement":"//div[@class=\"search_result_table\" or @class=\"search_result_box_brief\"]/ul/li", | |
| "nextLink":"//li[@class=\"next\"]/a", | |
| "wedata.net.id":77262 | |
| }, | |
| { | |
| "url":"^http://themelike\\.net/", | |
| "pageElement":"//div[@class='themelikeitem']", | |
| "nextLink":"//div[@class=\"navigation\"]/span[not(@class)]/following-sibling::a[1]", | |
| "wedata.net.id":76702 | |
| }, | |
| { | |
| "url":"^http://www\\.oist\\.jp/", | |
| "pageElement":"//div[@class='view-content']/*", | |
| "nextLink":"//li[@class='next last']/a", | |
| "wedata.net.id":77267 | |
| }, | |
| { | |
| "url":"^http://funtweets\\.com/", | |
| "pageElement":"id('tweet-block')/article", | |
| "nextLink":"id(\"tweet-block\")/nav/a[@class=\"btn float-right\"]", | |
| "wedata.net.id":76465 | |
| }, | |
| { | |
| "url":"^http://girlydrop\\.com/", | |
| "pageElement":"//ul[contains(@class,'archive_photo_list')]/li", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":77270 | |
| }, | |
| { | |
| "url":"^http://prosteamer\\.jp/", | |
| "pageElement":"id('content')/table/tbody/tr[td]", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":61376 | |
| }, | |
| { | |
| "url":"^http://www\\.upi\\.com/", | |
| "pageElement":"//div[starts-with(@class,'upi_item')]", | |
| "nextLink":"//td[@class='l'][last()]/a", | |
| "wedata.net.id":77276 | |
| }, | |
| { | |
| "url":"^http://.+\\.ndtv\\.com/", | |
| "pageElement":"((//div[@class='new_storylising' or @class='listing' or @class='nlist story_newslist' or @class='article_listing']|id('video_listing')|)/ul|//ul[@class='ndmv-article-list' or @id='Related'])/li|id('AlbumGrid')table/tbody/tr[td/table]", | |
| "nextLink":"//div[contains(@class,'pagination')]/*[self::span or @class='select']/following-sibling::a[1]|id('inside_pagination')/span/following-sibling::span[1]/a|//a[@class='pag-next' or img/@src='../images/next_colour.gif']|id('NextLink')", | |
| "wedata.net.id":80563 | |
| }, | |
| { | |
| "url":"^http://www\\.too\\.com/", | |
| "pageElement":"id(\"news_release_list\")/li", | |
| "nextLink":"//a[@class=\"link_next\"]", | |
| "wedata.net.id":74854 | |
| }, | |
| { | |
| "url":"^http://techichi\\.jp/.+", | |
| "pageElement":"id('news')//li|//h2/following-sibling::*[self::div[contains(@class, 'Detail')] or (@class='recommendBox' and not(../@class='detail'))]", | |
| "nextLink":"//li[@class='active']/following-sibling::li[1]/div/a | //a[@rel='prev' or ../@class='next']", | |
| "wedata.net.id":66823 | |
| }, | |
| { | |
| "url":"^http://www\\.221b\\.jp/", | |
| "pageElement":"//div[@class='IndexBarTop']/following-sibling::*[following-sibling::div/@class='IndexBarBottom']", | |
| "nextLink":"//td[@class='RightIndexBar']/a", | |
| "wedata.net.id":67068 | |
| }, | |
| { | |
| "url":"^http://www\\.ask\\.com/", | |
| "pageElement":"//div[@class='l-web-results web-results content-mid']/div[not(@class='web-results-header-title')]", | |
| "nextLink":"//li[@class='pagination-next']/a", | |
| "wedata.net.id":32372 | |
| }, | |
| { | |
| "url":"^http://247wallst\\.com/", | |
| "pageElement":"//div[@class=\"primary\"]//div[starts-with(@id,\"post-\")][id(\"nav-below\")]|//div[starts-with(@class,\"single-post hentry\")]/*[@class=\"entry-content\" or ((@class=\"entry-title\" or @id=\"user_controls\" or @class=\"post-meta\") and not(//span[@class=\"pagenum\"]/preceding-sibling::a))]", | |
| "nextLink":"//div[@class=\"nav-previous\"][not(./span)]/a|//a[@rel=\"next\"]|//div[@class=\"nav-previous\"]/span[@class=\"page-numbers current\"]/following-sibling::a[1]", | |
| "wedata.net.id":77288 | |
| }, | |
| { | |
| "url":"^http://hdreactor\\.org/", | |
| "pageElement":"id('dle-content')/div[@class='news']", | |
| "nextLink":"//a[.='Далее']", | |
| "wedata.net.id":80851 | |
| }, | |
| { | |
| "url":"^http://land-book\\.com/", | |
| "pageElement":"id(\"posts\")", | |
| "nextLink":"//span[@class=\"page current\"]/../following-sibling::li/a", | |
| "wedata.net.id":76488 | |
| }, | |
| { | |
| "url":"^http://lart\\.no/lpaste", | |
| "insertBefore":"id(\"rcol\")/*[last() + 1]", | |
| "pageElement":"id(\"rcontent\")", | |
| "nextLink":"//link[@rel=\"next\"]", | |
| "wedata.net.id":2724 | |
| }, | |
| { | |
| "url":"^http://www\\.rei\\.com/", | |
| "pageElement":"id('result-container')/div", | |
| "nextLink":"//a[@title='Next page']", | |
| "wedata.net.id":32445 | |
| }, | |
| { | |
| "url":"^http://beginners\\.biz/", | |
| "pageElement":"id('main-contents')/*[self::h1 or @class='contents']", | |
| "nextLink":"//p[@class='link-next2']/a|//li[1]/p[@class='m0-b f13em']/a", | |
| "wedata.net.id":64712 | |
| }, | |
| { | |
| "url":"^http://.+\\.gakki\\.me/", | |
| "pageElement":"id('ranking_list')/*|//dl[@class='wrap']/*|//div[@class='searh_result2']", | |
| "nextLink":"//a[contains(.,'次の')]", | |
| "wedata.net.id":66335 | |
| }, | |
| { | |
| "url":"^http://toonhole\\.com/", | |
| "pageElement":"id(\"comic\")/*", | |
| "nextLink":"//a[@rel=\"prev\"]", | |
| "wedata.net.id":77643 | |
| }, | |
| { | |
| "url":"^http://fleshbot\\.com/", | |
| "pageElement":"id(\"wrapper\")//div[contains(concat(\" \", @class, \" \"), \" post \")]", | |
| "nextLink":"id(\"wrapper\")//a[@class=\"current_page\"]/following-sibling::a[1]", | |
| "wedata.net.id":27510 | |
| }, | |
| { | |
| "url":"^http://favolog\\.org/.", | |
| "pageElement":"id('main')//*[self::h3[string-length(.)>6] or @class='tl-tweets' or @class='p-link' or self::tr[../../@class='tbl-cate-main']]", | |
| "nextLink":"id('main')/div[@class='pnavi']/b/following-sibling::a[1]", | |
| "wedata.net.id":39101 | |
| }, | |
| { | |
| "url":"^http://jr-soccer\\.jp/", | |
| "pageElement":"id('maincontents_inner')/ul[@class='snsbutton']/following-sibling::*[self::p or self::hr]|id('maincontents_inner')/ul[not(@class)]/li", | |
| "nextLink":"//div[@class='nextpage']/a|//a[@class='next']", | |
| "wedata.net.id":74857 | |
| }, | |
| { | |
| "url":"^http://rvlution\\.net/", | |
| "pageElement":"//table[@class='outline margin newspost' or @class='post margin']|//table[@class='outline margin threadlist']/tbody/tr[td]", | |
| "nextLink":"//a[@class='pagelink nextpage']", | |
| "wedata.net.id":76477 | |
| }, | |
| { | |
| "url":"^http://digimaga\\.net/", | |
| "pageElement":"//div[@class='article' or @class='thm-article']", | |
| "nextLink":"//a[@rel='next' or ../@class='postnavi-l']", | |
| "wedata.net.id":1820 | |
| }, | |
| { | |
| "url":"^http://rpgcomic\\.com/", | |
| "pageElement":"//figure[contains(@class,'photo-hires-item')]", | |
| "nextLink":"//a[@class='next-button']", | |
| "wedata.net.id":77282 | |
| }, | |
| { | |
| "url":"^http://netokaru\\.com/", | |
| "pageElement":"//div[@class=\"masonry\"]", | |
| "nextLink":"//a[@class=\"next page-numbers\"]", | |
| "wedata.net.id":80667 | |
| }, | |
| { | |
| "url":"^http://nypost\\.com/.+", | |
| "pageElement":"//div[@class='article-loop']/*[self::article or @class='rule']", | |
| "nextLink":"//div[@class='more-link']/a[//div/@class='article-loop']", | |
| "wedata.net.id":77649 | |
| }, | |
| { | |
| "url":"^http://konomanga\\.jp/", | |
| "pageElement":"id(\"contentBody\")[not(./div[@id=\"footnote\"])]/*[not(@class=\"prev_next pc_elements cF\")]|id(\"contentBody\")/*[not(@id=\"footnote\")]|id(\"contentBody\")/div[@id=\"footnote\"]/*[not(@class=\"prev_next pc_elements cF\")]|id(\"contentList\")[not(id(\"contentBody\"))]/ul", | |
| "nextLink":"//div[@class=\"wp-pagenavi\"]/a[@class=\"nextpostslink\"]", | |
| "wedata.net.id":74872 | |
| }, | |
| { | |
| "url":"^http://say-move\\.org/", | |
| "pageElement":"//table[@style='word-wrap: break-word']/tbody/tr", | |
| "nextLink":"//b[@class='linkpageactive']/following-sibling::a", | |
| "wedata.net.id":28277 | |
| }, | |
| { | |
| "url":"^http://cruel\\.org/sd/", | |
| "pageElement":"//font[@size=\"+1\"][./div]|//font[@size=\"+1\"][./div]/preceding-sibling::*[preceding-sibling::hr[not(@color)]]|//div[@style=\"font-size:larger;\"][count(./p)>1]|//div[@style=\"font-size:larger;\"][count(./p)>1]/preceding-sibling::*[preceding-sibling::hr[not(@color)]]|//div[@style=\"font-size:larger;\"][count(./p)>1]/following-sibling::hr[1]|//hr[not(@color)][1]/following-sibling::*[following-sibling::address][not(//a[text()=\"NEXT\"])]", | |
| "nextLink":"//a[.='NEXT']", | |
| "wedata.net.id":70059 | |
| }, | |
| { | |
| "url":"http://omata-pic\\.com/", | |
| "pageElement":"id(\"main_contents\")//div[@class=\"picture_block\"]|id(\"view_main_content\")/div[@class=\"members_picture_block\"]", | |
| "nextLink":"//div[@class=\"paging_container\"]//ul/li[a[@class=\"do\"]]/following-sibling::li/a", | |
| "wedata.net.id":74752 | |
| }, | |
| { | |
| "url":"^http://thbecker\\.net/", | |
| "pageElement":"//h4|//table", | |
| "nextLink":"//div[contains(@class,\"thb-page-links\")]/text()[number()>0]/following-sibling::a[1]", | |
| "wedata.net.id":77223 | |
| }, | |
| { | |
| "url":"^http://userporn\\.com/", | |
| "pageElement":"//div[contains(concat(\" \", @class, \" \"), \" index_video_panel \")]", | |
| "nextLink":"//a[contains(@class,\"active\")]/following-sibling::a[1]", | |
| "wedata.net.id":55337 | |
| }, | |
| { | |
| "url":"^https://yamadaya\\.tv/", | |
| "pageElement":"//div[@class='item_c clearfix']", | |
| "nextLink":"//a[@class='nav_next']", | |
| "wedata.net.id":80833 | |
| }, | |
| { | |
| "url":"^https://kakuyomu\\.jp/", | |
| "pageElement":"//div[starts-with(concat(' ',@class), ' widget-') and contains(concat(@class, ' '),'-right ')]/div[contains(concat(' ',@class,' '),' widget-work ')]|id('contentMain-inner')", | |
| "nextLink":"//p[@class='widget-pagerNext']/a|id('contentMain-nextEpisode')/a", | |
| "wedata.net.id":79966 | |
| }, | |
| { | |
| "url":"^http://betanews\\.com/", | |
| "pageElement":"//div[@class='articleBlurb']", | |
| "nextLink":"//div[@class='loadMore']/a", | |
| "wedata.net.id":31376 | |
| }, | |
| { | |
| "url":"^http://www\\.hmr\\.jp/", | |
| "pageElement":"//div[@class='items']/div", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":38636 | |
| }, | |
| { | |
| "url":"^http://logipara\\.com/", | |
| "pageElement":"//div[@class=\"contents\"]/table[@class=\"navi\"]/following-sibling::node()[following-sibling::table[@class=\"navi\"]]", | |
| "nextLink":"//div/table[@class=\"navi\"]/tbody/tr/td[@class=\"navinext\"]/a", | |
| "wedata.net.id":54440 | |
| }, | |
| { | |
| "url":"^http://cospatio\\.com/", | |
| "pageElement":"id(\"contents_center_inner\")/div[@class=\"itemlist\"][position()=1]", | |
| "nextLink":"//div[@class=\"pages\"][position()=1]/ul/li/a[contains(text(),'»')]", | |
| "wedata.net.id":72565 | |
| }, | |
| { | |
| "url":"^http://bandcamp\\.com/", | |
| "pageElement":"//ul[@class='item_list']/li", | |
| "nextLink":"//a[@class='nextprev next round4']", | |
| "wedata.net.id":40431 | |
| }, | |
| { | |
| "url":"^http://horiemon\\.com/", | |
| "pageElement":"//article[@class=\"entry-page\"]/*[@class=\"entry\" or self::header]", | |
| "nextLink":"//footer[@class=\"next-back\"]/p[@class=\"next\"]/a", | |
| "wedata.net.id":74697 | |
| }, | |
| { | |
| "url":"^http://nttxstore\\.jp/", | |
| "pageElement":"id(\"schphoto itemsch\")", | |
| "nextLink":"//div[@class=\"paging\"]/span[@class=\"cur\"]/following-sibling::*[1][self::span]/a", | |
| "wedata.net.id":40955 | |
| }, | |
| { | |
| "url":"^http://dropbooks\\.tv/", | |
| "pageElement":"id(\"main2col\")/node()[@class=\"content_list\" or not(self::*)]|id(\"main-content\")/ul[@class=\"content_list\"]/li", | |
| "nextLink":"//a[text()=\"次へ\"]", | |
| "wedata.net.id":74911 | |
| }, | |
| { | |
| "url":"^http://authority\\.jp/", | |
| "pageElement":"//div[@class=\"unit\"]", | |
| "nextLink":"//div[@class=\"pagination\"][2]//a[@class=\"prevnext\"]", | |
| "wedata.net.id":31152 | |
| }, | |
| { | |
| "url":"^http://winfuture\\.de/", | |
| "pageElement":"//div[@class='pagerLeft'][1]/preceding-sibling::*[not(@class='0_hidden')]|//div[@class='calendar_box month']", | |
| "nextLink":"//a[em/@class='ml0']|//div[@class='month_links']/span[strong]/following-sibling::span/a", | |
| "wedata.net.id":32549 | |
| }, | |
| { | |
| "url":"^http://joshinweb\\.jp/", | |
| "pageElement":"//table[@bgcolor]/tbody/tr", | |
| "nextLink":"//td[@class='fsM'][@valign='bottom']/a[font]/following-sibling::a[1]", | |
| "wedata.net.id":31123 | |
| }, | |
| { | |
| "url":"^http://hidefporn\\.ws/", | |
| "pageElement":"//div[@id=\"dle-content\"]", | |
| "nextLink":"//div[@id='dle-content']/div[@class='pager']/span[@class='navigation']/span/following-sibling::a", | |
| "wedata.net.id":80822 | |
| }, | |
| { | |
| "url":"^http://www\\.tv\\.com/", | |
| "pageElement":"//div[@class='_col_a']/div/ul[@class='stories' or @class='m hub_list'][1]/li[not(@class='_pagination')]|//ul[@class='photos _clearfix']|//div[@class='content editable complex']", | |
| "nextLink":"//a[.='>']", | |
| "wedata.net.id":74674 | |
| }, | |
| { | |
| "url":"^http://gfxdomain\\.co/", | |
| "pageElement":"id('main')/div", | |
| "nextLink":"//a[@class='nextpostslink']", | |
| "wedata.net.id":77366 | |
| }, | |
| { | |
| "url":"^http://fbrushes\\.com/", | |
| "pageElement":"//ul[@class='list']/li", | |
| "nextLink":"//li[span/@class='pagination_active']", | |
| "wedata.net.id":29111 | |
| }, | |
| { | |
| "url":"^http://hamarepo\\.com/", | |
| "pageElement":"id(\"l_column\")/div[@class=\"explain\"]//div[@id=\"sbmContents\"]/following-sibling::*[following-sibling::div[@class=\"a_navi\"]]|id(\"l_column c_column\")//div[@class=\"answer kininaru\"]//li[not(@class)][not(./div[@id=\"inner_banner\"])]|//div[@class='coments']", | |
| "nextLink":"//p[@class=\"an_next\"][count(//*[@class=\"a_navi\"])<3]/a", | |
| "wedata.net.id":64839 | |
| }, | |
| { | |
| "url":"^https?://tamajun\\.net", | |
| "pageElement":"//div[@class=\"archive__item\"]|id(\"wp_page_numbers\")/preceding-sibling::*", | |
| "nextLink":"//a[@rel=\"next\"][not(@href=\"http://tamajun.net/page/2/\")]|//li[@class=\"active_page\"]/following-sibling::li[1]/a", | |
| "wedata.net.id":80954 | |
| }, | |
| { | |
| "url":"^https?://github\\.com/", | |
| "pageElement":"//*[(self::div or self::ul) and (contains(concat(\" \",normalize-space(@class),\" \"), \" code-list \") or contains(concat(\" \",normalize-space(@class),\" \"), \" user-list \") or contains(concat(\" \",normalize-space(@class),\" \"), \" repo-list \"))]/*[(self::div or self::li) and not(contains(concat(\" \",normalize-space(@class),\" \"), \" paginate-container \"))]", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":29238 | |
| }, | |
| { | |
| "url":"^http://techfrag\\.com/", | |
| "pageElement":"//div[@class=\"post\"]", | |
| "nextLink":"//link[@rel=\"next\"]", | |
| "wedata.net.id":77370 | |
| }, | |
| { | |
| "url":"^http://yourlust\\.com/", | |
| "pageElement":"//div[contains(concat(' ', @class, ' '), ' list_videos ') or contains(concat(' ', @class, ' '), ' list_models ')]//div[contains(concat(' ', @class, ' '), ' item ')]", | |
| "nextLink":"//div[contains(concat(' ', @class, ' '), ' pagination ')]//span/following-sibling::a[1]", | |
| "wedata.net.id":58106 | |
| }, | |
| { | |
| "url":"^https://moz\\.com/blog", | |
| "pageElement":"//div[@class='row'][article]", | |
| "nextLink":"//a[@class='pager-right']", | |
| "wedata.net.id":42118 | |
| }, | |
| { | |
| "url":"^http://goodbooks\\.jp/", | |
| "pageElement":"id(\"content\")/div[@class=\"box\"]/div[@class=\"box-content\"]", | |
| "nextLink":"id(\"content\")//li[@class=\"next_page\"]/a", | |
| "wedata.net.id":73740 | |
| }, | |
| { | |
| "url":"^http://welovewp\\.com/", | |
| "pageElement":"//article", | |
| "nextLink":"//li[@class=\"previous\"]/a", | |
| "wedata.net.id":2083 | |
| }, | |
| { | |
| "url":"^http://tt-house\\.com/", | |
| "pageElement":"//div[@class=\"bnav\"]/preceding-sibling::*", | |
| "nextLink":"//div[@class=\"bnav\"]/b[count(./a)>1 or ./a[@href=\"http://tt-house.com/page/2\" or contains(@href,\"http://tt-house.com/page/2?s=\")]]/a[last()]", | |
| "wedata.net.id":42153 | |
| }, | |
| { | |
| "url":"http://.*\\.time\\.com/", | |
| "pageElement":"//div[@class='item selected']/div", | |
| "nextLink":"//a[@class='item-next']", | |
| "wedata.net.id":73786 | |
| }, | |
| { | |
| "url":"^http://himado\\.in/\\?", | |
| "pageElement":"id(\"thumb\")/tbody/tr|id(\"content\")/div[@class=\"datablock\"]/node()[not(@class=\"rank_tabline\" or @class=\"pagenavi\")]", | |
| "nextLink":"//a[@class=\"npagelink\"][last()]|id(\"content\")/div[@class=\"datablock\"]/div[@class=\"pagenavi\"]/a[last()]", | |
| "wedata.net.id":32954 | |
| }, | |
| { | |
| "url":"^http://eplus\\.jp/sys/", | |
| "pageElement":"id('contents')//div[@class='title-result']/table/tbody/tr", | |
| "nextLink":"//a[.='次へ']", | |
| "wedata.net.id":76343 | |
| }, | |
| { | |
| "url":"^http://dol\\.vc/search", | |
| "pageElement":"id(\"result_items\")//li", | |
| "nextLink":"//a[@title=\"next page\"]", | |
| "wedata.net.id":33037 | |
| }, | |
| { | |
| "url":"^http://dezignus\\.com/", | |
| "pageElement":"//div[@class='entrys']", | |
| "nextLink":"id('paginator')//td[span/strong]/following-sibling::td[1]/span/a", | |
| "wedata.net.id":818 | |
| }, | |
| { | |
| "url":"^http://jp\\.ask\\.com/", | |
| "pageElement":"//div[@class='wresult tsrc_tled']", | |
| "nextLink":"id('nextPageLink')", | |
| "wedata.net.id":26684 | |
| }, | |
| { | |
| "url":"^http://x-comic\\.info/", | |
| "pageElement":"//div[contains(concat(\" \",@class,\" \"),\" OUTLINE \")]", | |
| "nextLink":"//div[contains(concat(\" \",@class,\" \"),\" CONTENTS_FOOTER \")][2]/span[contains(concat(\" \",@class,\" \"),\" STRONG \")]/text()[string-length(.)>2]/following-sibling::a", | |
| "wedata.net.id":57154 | |
| }, | |
| { | |
| "url":"^http://netagear\\.net/", | |
| "pageElement":"//ul[@class='article']/li", | |
| "nextLink":"id('page-select')/a[last()]", | |
| "wedata.net.id":77833 | |
| }, | |
| { | |
| "url":"^http://ffffound\\.com/", | |
| "insertBefore":"id(\"assets\")/div[last()]", | |
| "pageElement":"//blockquote", | |
| "nextLink":"id(\"paging-next\")", | |
| "wedata.net.id":452 | |
| }, | |
| { | |
| "url":"^https://booklink\\.me/", | |
| "pageElement":"//table//tr[@bgcolor='#f0f0f0' and td[@width='80' or @style='width:60px;']]/following-sibling::tr", | |
| "nextLink":"//a[@class='n'][contains(font,'下一页')]", | |
| "wedata.net.id":74982 | |
| }, | |
| { | |
| "url":"^http://pornxs\\.com/.+", | |
| "pageElement":"//div[@class=\"profile-content-right\"]/div/div[@class=\"box-content\"]|//div[@class=\"new-videos\"] |//div[@class=\"partners-content static\"]/div[@class=\"content\"]", | |
| "nextLink":"//a[@class=\"pagination-next\"]", | |
| "wedata.net.id":77157 | |
| }, | |
| { | |
| "url":"^http://www.hotgoo.com/", | |
| "pageElement":"//*[@id=\"category\"]/table[2]/tbody/tr[1]/td[1]/table/tbody/tr[2]/td[2]//p | //td[@width=\"800\"]//p", | |
| "nextLink":"//div[@class=\"pages\"]/a[last()]", | |
| "wedata.net.id":77476 | |
| }, | |
| { | |
| "url":"http://www.eporner.com/", | |
| "pageElement":"//*[@id=\"panel-right\"]/div[@class=\"mb\"] | //*[@id=\"container\"] | //div[@class=\"MBouter\"]", | |
| "nextLink":"//span[@class=\"that\"]/following-sibling::a[1] | //a[@title=\"Next page\"]", | |
| "wedata.net.id":77152 | |
| }, | |
| { | |
| "url":"^https://kinarino\\.jp/", | |
| "pageElement":"id('ContentLeft')/div", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":77481 | |
| }, | |
| { | |
| "url":"^http://camgirl.gallery", | |
| "pageElement":"//*[@id=\"list-search-images\"]/div/div[contains(concat(\" \", @class, \" \"), \"list-item\")]", | |
| "nextLink":"//a[text()=\"Next ›\"]", | |
| "wedata.net.id":77482 | |
| }, | |
| { | |
| "url":"^http://mylust\\.com/.+", | |
| "insertBefore":"//*[@class=\"pagination\"]", | |
| "pageElement":"//*[@class=\"list_videos\"] | //*[@class=\"span3\"]/div[@class=\"box\"]", | |
| "nextLink":"//div[contains(@class,'pagination-right')]/a | //span[@class=\"current\"]/following-sibling::a", | |
| "wedata.net.id":77151 | |
| }, | |
| { | |
| "url":"^http://devthemez\\.com", | |
| "pageElement":"//ul[@class='themes-list clearfix']", | |
| "nextLink":"//li[@class='next_page']/a", | |
| "wedata.net.id":73909 | |
| }, | |
| { | |
| "url":"^http://voguegirl\\.jp/", | |
| "pageElement":"//div[contains(@class,'pagingNav')]/preceding-sibling::*[self::article or self::section]|//header[@class='resultHead']/following-sibling::div[1]/*", | |
| "nextLink":"//a[@class='nextLink']", | |
| "wedata.net.id":75010 | |
| }, | |
| { | |
| "url":"^http://typemoon\\.com/", | |
| "pageElement":"id(\"paginator\")/preceding-sibling::*", | |
| "nextLink":"//a[@title=\"1ページ後を表示\"]", | |
| "wedata.net.id":49784 | |
| }, | |
| { | |
| "url":"^https?://macnemo\\.de/", | |
| "pageElement":"//div[@class='entry index']/*", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":49529 | |
| }, | |
| { | |
| "url":"^http://fuminners\\.jp/", | |
| "pageElement":"//ul[@class=\"post-lists\"]/li|//div[@class=\"single-post\"]/p[@class=\"excerpt-next-page\" or not(./*)]/preceding-sibling::*", | |
| "nextLink":"//a[@class=\"next page-numbers\"]", | |
| "wedata.net.id":77548 | |
| }, | |
| { | |
| "url":"^http://twilog\\.org/.+", | |
| "pageElement":"id('info')/following-sibling::*[following-sibling::ul][not(contains(@class,'nav-link'))]", | |
| "nextLink":"//ul/li[@class='nav-next']/a", | |
| "wedata.net.id":29777 | |
| }, | |
| { | |
| "url":"^http://toppixxx\\.com/", | |
| "pageElement":"//div[@class=\"gallerythumbs\"]/preceding-sibling::node()", | |
| "nextLink":"//a[(text()=\"Next page >\")]", | |
| "wedata.net.id":77497 | |
| }, | |
| { | |
| "url":"^http://hjav5278\\.com/", | |
| "pageElement":"//ul", | |
| "nextLink":"//a[(text()=\"下頁\")]", | |
| "wedata.net.id":80986 | |
| }, | |
| { | |
| "url":"^http://freecode\\.com/", | |
| "pageElement":"//div[starts-with(@id,'release_')]", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":34256 | |
| }, | |
| { | |
| "url":"^http://bitmuzic\\.com/", | |
| "pageElement":"id('archive')//ul[@class='posts']/li", | |
| "nextLink":"//div[@class='navigation']/p[@class='more']/a[1]", | |
| "wedata.net.id":77132 | |
| }, | |
| { | |
| "url":"^http://webcomics\\.jp/", | |
| "pageElement":"id(\"main\")/div[@class=\"list\"]/div[contains(concat(\" \",@class,\" \"),\" entry \")]", | |
| "nextLink":"//li[@class=\"next\"]/a", | |
| "wedata.net.id":76288 | |
| }, | |
| { | |
| "url":"^http://bbs\\.nga\\.cn/", | |
| "pageElement":"id(\"topicrows\")/tbody", | |
| "nextLink":"//td[./a[contains(@class,\"invert\")]]/following-sibling::td[1]/a|//a[contains(@title,\"下一页\")]", | |
| "wedata.net.id":80775 | |
| }, | |
| { | |
| "url":"^http://fontzone\\.net/", | |
| "pageElement":"//div[@class='font'][div/@class='font-name']", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":77123 | |
| }, | |
| { | |
| "url":"^http://okwave\\.jp/qa/", | |
| "pageElement":"//div[@class='o_box']", | |
| "nextLink":"//a[contains(span/@class,'arrow_next')]", | |
| "wedata.net.id":76282 | |
| }, | |
| { | |
| "url":"^http://tweakers\\.net/", | |
| "pageElement":"id('listing')//tbody/tr", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":65328 | |
| }, | |
| { | |
| "url":"^http://netgeek\\.biz/", | |
| "pageElement":"id(\"articles\")", | |
| "nextLink":"id(\"nav-below\")/div[@class=\"nav-previous\"]//a", | |
| "wedata.net.id":74807 | |
| }, | |
| { | |
| "url":"^http://mataani\\.com/", | |
| "pageElement":"//div[@class=\"content\"]/div", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":25995 | |
| }, | |
| { | |
| "url":"http://gigazine\\.net/", | |
| "pageElement":"//div[@class=\"content\"]", | |
| "nextLink":"//div[@id=\"nextpage\"]/a", | |
| "wedata.net.id":1905 | |
| }, | |
| { | |
| "url":"^http://onikuoic\\.com", | |
| "pageElement":"//article[./following-sibling::article or @class=\"article last-article\"]|(//div[@class=\"article-body-inner\"]/div[@class=\"amazon Default\"][1]/preceding-sibling::br[1]/preceding-sibling::node()|//header[@class=\"article-header\"])[ancestor::article[@class=\"article first-article\"][not(./following-sibling::article)]]", | |
| "nextLink":"//a[@rel=\"next\"][count(//article)>1]|//a[@rel=\"prev\"][count(//article)=1]", | |
| "wedata.net.id":80869 | |
| }, | |
| { | |
| "url":"^http://nitroyss\\.jp/", | |
| "pageElement":"id(\"main\")/div[contains(concat(\" \", @class, \" \"), \" entry \")]", | |
| "nextLink":"id(\"main\")/div[@class=\"wp-pagenavi\"]/a[@class=\"nextpostslink\"]", | |
| "wedata.net.id":61910 | |
| }, | |
| { | |
| "url":"^http://syosetu\\.com/", | |
| "pageElement":"id('favuser') | id('writtingnovellist') | //table | //div[@class='novelcomment_list'] | //ul[@class='bloglist'] | //ul[@id='favuser']", | |
| "nextLink":"//div[@class='pager_idou']/a[@title='next page'] | //div[@class='page_bar']//a[contains( ./text(), '>>')]", | |
| "wedata.net.id":77750 | |
| }, | |
| { | |
| "url":"^http://moepedia\\.jp/", | |
| "pageElement":"//div[@class='search_result']/dl", | |
| "nextLink":"//ul[@class='pageNav01']/li[last()]/a", | |
| "wedata.net.id":64688 | |
| }, | |
| { | |
| "url":"^http://geekdad\\.com/", | |
| "pageElement":"//div[@class='page-link']/preceding-sibling::*[not(@id='jp-relatedposts')]|id('content')/article[id('nav-below')]", | |
| "nextLink":"//div[@class='page-link']/text()[string-length(normalize-space()) > 0][last()]/following-sibling::a[1]|//div[@class='nav-previous']/a", | |
| "wedata.net.id":77233 | |
| }, | |
| { | |
| "url":"^http://g-mania\\.biz/", | |
| "pageElement":"//div[@class='navigation']/preceding-sibling::div", | |
| "nextLink":"//div[@class='alignleft']/a", | |
| "wedata.net.id":2167 | |
| }, | |
| { | |
| "url":"http://www.noracam.com", | |
| "pageElement":"//div[@class=\"content\"]/div[@class=\"bloc-video\"]", | |
| "nextLink":"//ul[@class=\"ulPagination\"]/li[last()]/a", | |
| "wedata.net.id":77520 | |
| }, | |
| { | |
| "url":"^http://www.nuvid.com/", | |
| "pageElement":"//div[@class=\"box-tumb video-item\"] | //div[contains(concat(\" \", @class, \" \"), \" video-item \")] | //div[contains(concat(\" \", @class, \" \"), \" block-tumb \")]/descendant::div[contains(concat(\" \", @class, \" \"), \" holder \")]rnrn", | |
| "nextLink":"//a[@class=\"next1\"]", | |
| "wedata.net.id":56038 | |
| }, | |
| { | |
| "url":"^http://bakusai\\.com/", | |
| "pageElement":"id(\"res_list\")", | |
| "nextLink":"//span[@class=\"paging_nextlink\"]/a", | |
| "wedata.net.id":61099 | |
| }, | |
| { | |
| "url":"^http://.+\\.ew\\.com/", | |
| "pageElement":"//div[@class='article-body']//div[@class='field-item even' or contains(@class,'field field-name-body')]/*[not(@class='related-content-wrapper')]|//div[@class='search-result']", | |
| "nextLink":"//li[contains(@class,'current')]/following-sibling::li/a|//div[@class='search-next']/a", | |
| "wedata.net.id":29833 | |
| }, | |
| { | |
| "url":"^https?://kudok\\.com/", | |
| "pageElement":"id('autopager_custom')|//div[@class='signature']", | |
| "nextLink":"//a[@rel='prev']", | |
| "wedata.net.id":29522 | |
| }, | |
| { | |
| "url":"^https?://qiita\\.com/", | |
| "pageElement":"//div[@class='tableList']/article|//div[@class='tagsIndexTagsList' or @class='searchResult']|//div[@class='container']/ul[@class='list-unstyled']/li|//table[contains(concat(' ',@class,' '),' adventCalendarList ')]/tbody/tr", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":75019 | |
| }, | |
| { | |
| "url":"^https://mojang\\.com/", | |
| "pageElement":"//ul[@class='post-list list-unstyled']/li", | |
| "nextLink":"//a[@class='btn btn-pagination pull-right']", | |
| "wedata.net.id":75018 | |
| }, | |
| { | |
| "url":"^http://textview\\.jp/", | |
| "pageElement":"id('ContentMain')/section/section", | |
| "nextLink":"//a[@class='next page-numbers']", | |
| "wedata.net.id":54498 | |
| }, | |
| { | |
| "url":"^http://czechhd\\.net/", | |
| "pageElement":"//div[@class=\"nag cf\"]", | |
| "nextLink":"//a[(text()=\"Next »\")]", | |
| "wedata.net.id":80566 | |
| }, | |
| { | |
| "url":"^http://chiharuh\\.jp/", | |
| "pageElement":"//div[@class='post_title']|//td[@class='entry-content-right']/p|id('boxes')|id('comments')/*[@class='commentlist' or self::h3]", | |
| "nextLink":"//a[@rel='prev' or .='Load more posts']", | |
| "wedata.net.id":74863 | |
| }, | |
| { | |
| "url":"^http://oporn\\.com.+$", | |
| "pageElement":"//div[@id=\"maincol\"]/div[@class=\"result-body\"]", | |
| "nextLink":"//li[@class=\"preNext\"][last()][not(./following-sibling::li)]/a", | |
| "wedata.net.id":50494 | |
| }, | |
| { | |
| "url":"^http://dime.jp/genre/", | |
| "pageElement":"//div[@class='entryBody clearfix']", | |
| "nextLink":"//a[span/@class='next']", | |
| "wedata.net.id":66979 | |
| }, | |
| { | |
| "url":"^http://aniguide\\.ru/", | |
| "pageElement":"//div[@class='catalog']/*", | |
| "nextLink":"id('paginator3000')//td[.//strong]/following-sibling::td[1]//a", | |
| "wedata.net.id":30195 | |
| }, | |
| { | |
| "url":"^http://mangapark\\.me", | |
| "pageElement":"id(\"viewer\")//a[img]|//div[@class=\"ls1\"]/div", | |
| "nextLink":"//a[contains(text(),\"ext▶\")]", | |
| "wedata.net.id":77669 | |
| }, | |
| { | |
| "url":"^http://mj-news\\.net/", | |
| "pageElement":"//div[contains(@class,\"main-content-left\")]/div[contains(@class,\"content-article-title\")][1]|//div[@class=\"article-controls\"]|id(\"padSection\")/preceding-sibling::*[not(.//img[@alt=\"bnr_linkbnr\" or @alt=\"bnr_chankanchan_boshu_long\"])]|//img[@class=\"logo\"][//link[@rel=\"canonical\"][@href=\"http://mj-news.net/\"]]", | |
| "nextLink":"//a[@rel=\"prev\"]|//div[@class=\"logo-image\"][//a[@rel=\"next\"][not(//a[@rel=\"prev\"])]]/a", | |
| "wedata.net.id":77310 | |
| }, | |
| { | |
| "url":"^http://figsoku\\.net/", | |
| "pageElement":"//div[@class=\"entry\"][//link[@rel=\"canonical\" or @rel=\"prev\"][@href=\"http://figsoku.net/\" or contains(@href,\"page\")]]|//article[not(//link[@rel=\"canonical\" or @rel=\"prev\"][@href=\"http://figsoku.net/\" or contains(@href,\"page\")] or //div[@class=\"ently_text\"])]|(//*[@class=\"ently_title\" or @class=\"ently_navi\"]|//div[@class=\"wama\"]/preceding-sibling::*)[//div[@class=\"ently_text\"]]|id(\"comment_outline\")", | |
| "nextLink":"//link[@rel=\"next\"]|id(\"pager\")/li[@class=\"current\"]/following-sibling::li/a", | |
| "wedata.net.id":77557 | |
| }, | |
| { | |
| "url":"^http://mf-fleur\\.jp/", | |
| "pageElement":"//section[not(@id=\"twitter\")]", | |
| "nextLink":"//a[text()=\"次へ\"]", | |
| "wedata.net.id":66822 | |
| }, | |
| { | |
| "url":"^https?://dating\\.ru/", | |
| "pageElement":"//tr[td[span[@class=\"photo_num\"]]]", | |
| "nextLink":"//td[@class=\"current_page\"]/following-sibling::td[1]/a", | |
| "wedata.net.id":64840 | |
| }, | |
| { | |
| "url":"^https://gunosy\\.com/", | |
| "pageElement":"//div[@class='list_content']", | |
| "nextLink":"//link[@rel='next']", | |
| "wedata.net.id":64505 | |
| }, | |
| { | |
| "url":"^http://erotube\\.org/", | |
| "pageElement":"//div[@class='mainEntryBlock'][.//a[@href='#top']]", | |
| "nextLink":"//div[@class='pageLink']/a[contains(text(),'次')]", | |
| "wedata.net.id":70122 | |
| }, | |
| { | |
| "url":"^http://lineblog\\.me/", | |
| "pageElement":"id(\"main-inner\")/article/*[not(@class=\"pager article-pager-type2\" or contains(@id,\"ldblog_related_articles\"))]", | |
| "nextLink":"//li[@class=\"prev\" or @class=\"paging-next\"]/a", | |
| "wedata.net.id":77166 | |
| }, | |
| { | |
| "url":"^http://ji-sedai\\.jp/", | |
| "pageElement":"//div[starts-with(@class,'mod-pager mod-')]/preceding-sibling::*[not(@class='mod-p')]", | |
| "nextLink":"id('pjaxsite-content')//td[@class='mod-numpager-old' or @class='mod-siblingpager-old-arrow']//a", | |
| "wedata.net.id":74739 | |
| }, | |
| { | |
| "url":"^http://unicamtalk.com", | |
| "pageElement":"//div[@itemscope]", | |
| "nextLink":"//div[@class=\"buttomNav\"]/a[last()] | //a[text()=\"Next\"]", | |
| "wedata.net.id":77676 | |
| }, | |
| { | |
| "url":"^http://snipplr\\.com/", | |
| "pageElement":"//ol[@class='snippets marg']/li", | |
| "nextLink":"//div[@class='paging marg']/a[contains(.,'Next')]", | |
| "wedata.net.id":832 | |
| }, | |
| { | |
| "url":"^http://mainichi.jp/.+", | |
| "pageElement":"//section/ul/li", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":1580 | |
| }, | |
| { | |
| "url":"http://kabuline\\.com/", | |
| "pageElement":"//div[@class='ac_cell']", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":80688 | |
| }, | |
| { | |
| "url":"^https://jobtalk\\.jp/", | |
| "pageElement":"//ul[@class='company-list']/li", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":76994 | |
| }, | |
| { | |
| "url":"^http://quetter\\.com/", | |
| "pageElement":"id(\"contents\")/div[contains(concat(\" \",@class,\" \"),\" list \")]", | |
| "nextLink":"id(\"contents\")/div[contains(concat(\" \",@class,\" \"),\" pagination \")]/span/a[contains(text(),\">\")]", | |
| "wedata.net.id":30555 | |
| }, | |
| { | |
| "url":"^https://sohabr\\.net/", | |
| "pageElement":"//div[@class='posts']/div", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":77189 | |
| }, | |
| { | |
| "url":"^https://k\\.xpg\\.jp/", | |
| "pageElement":"//ol/li | id('main_f')/table/tbody/tr", | |
| "nextLink":"//span[@class='s']/following-sibling::a[1]", | |
| "wedata.net.id":77452 | |
| }, | |
| { | |
| "url":"^http://sakifan\\.com/", | |
| "pageElement":"id('main')//div[@class='entry' or @class='kizi']", | |
| "nextLink":"//div[@class='pagination']/a[contains(.,'Next')]|//div[@class='kizi']/p/a[//div[@class='blogbox']//a[contains(.,'SS')]][number(substring-before(substring-after(self::a/@href,'post-'),'/'))>number(substring-before(substring-after(//link[@rel='canonical']/@href,'post-'),'/'))]|//div[@class='kizi']/p/a[//div[@class='blogbox']//a[contains(.,'SS')]][number(substring-before(substring-after(self::a/@href,'.com/'),'/'))>number(substring-before(substring-after(//link[@rel='canonical']/@href,'.com/'),'/'))]|//div[@class='p-navi clearfix']//dt[contains(.,'NEXT')]/following-sibling::dd[1]/a", | |
| "wedata.net.id":74973 | |
| }, | |
| { | |
| "url":"^http://codenote\\.jp/", | |
| "pageElement":"//ul[@class=\"code-list-area\"]|//div[@class=\"contents-area\"]//div[@class=\"new-code-area\"]", | |
| "nextLink":"//div[@class=\"next\"]/a", | |
| "wedata.net.id":57204 | |
| }, | |
| { | |
| "url":"http://kabuline\\.com/", | |
| "pageElement":"//ul[@class='tl']/li", | |
| "nextLink":"//a[@title='次のページ']", | |
| "wedata.net.id":80689 | |
| }, | |
| { | |
| "url":"http://kabuline\\.com/", | |
| "pageElement":"id('CodeListMainInner')//li", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":80690 | |
| }, | |
| { | |
| "url":"^http://sukupara\\.jp/", | |
| "pageElement":"//div[@class='magarea']|id('story_title')|//table[contains(@class,'contents-tbl01 tbl-') or @class='g']/tbody/tr[td]|//div[@id='box_base_inner' or @class='box-contents clearfix']", | |
| "nextLink":"id('next-page-btn after-story-btn')/a|//*[contains(@class,'page_list') or @class='page-jump']/span[not(./a)]/following-sibling::span[1]/a", | |
| "wedata.net.id":59614 | |
| }, | |
| { | |
| "url":"^http://pixdaus\\.com/", | |
| "pageElement":"id(\"items\")/div[@class=\"clearfix\"]/div[@class=\"item mediumSquare\"]", | |
| "nextLink":"//a[@class=\"page current\"]/following-sibling::a", | |
| "wedata.net.id":62413 | |
| }, | |
| { | |
| "url":"^http://mcdn360\\.com/", | |
| "pageElement":"//div[starts-with(@id,'post-')]", | |
| "nextLink":"//p[@class=\"previous\"]/a", | |
| "wedata.net.id":76369 | |
| }, | |
| { | |
| "url":"^http://kai-you\\.net/", | |
| "pageElement":"//div[@class='m-recent-list']/*", | |
| "nextLink":"//li[@class='is-active m-list-pager-number-item']/following-sibling::li[1]/a", | |
| "wedata.net.id":74925 | |
| }, | |
| { | |
| "url":"^http://mangafap\\.com", | |
| "pageElement":"id(\"p\")/parent::a|//ul[@class=\"media-list\"]/li", | |
| "nextLink":"id(\"p\")/parent::a[not(@data-toggle)]|//a[@rel=\"next\"]", | |
| "wedata.net.id":77621 | |
| }, | |
| { | |
| "url":"^http://sns-gazo\\.co/", | |
| "pageElement":"id('post_wrap')", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":77624 | |
| }, | |
| { | |
| "url":"^http://vr-zone\\.com/", | |
| "pageElement":"//div[@class='item-isotope'][article]", | |
| "nextLink":"//a[@class='nextpostslink']", | |
| "wedata.net.id":32588 | |
| }, | |
| { | |
| "url":"^http://lite-ra\\.com/", | |
| "pageElement":"id(\"entryBody\")/*", | |
| "nextLink":"//a[@class='link_next']", | |
| "wedata.net.id":74940 | |
| }, | |
| { | |
| "url":"japanese-bukkake\\.net", | |
| "pageElement":"id('main-col')", | |
| "nextLink":"//span[@class='previous-entries']/a", | |
| "wedata.net.id":74930 | |
| }, | |
| { | |
| "url":"^http://jav-fan\\.com/", | |
| "pageElement":"//div[@id=\"content\"]", | |
| "nextLink":"//a[(text()=\"Next\")]", | |
| "wedata.net.id":80818 | |
| }, | |
| { | |
| "url":"^http://steamsale\\.me", | |
| "pageElement":"//div[@align=\"center\"]/preceding-sibling::*", | |
| "nextLink":"//ul[@class='pagination pagination-lg']/li[@class='active']/following-sibling::li[1]/a", | |
| "wedata.net.id":77216 | |
| }, | |
| { | |
| "url":"^http://mankaki\\.jp/", | |
| "pageElement":"id(\"Center\")/div/div/div[contains(concat(\" \",@class,\" \"),\" pagerRelative \")]/following-sibling::*[following-sibling::div[contains(concat(\" \",@class,\" \"),\" pagerRelative \")]]|id(\"mangaDetailBox mangaImage mangaBottomBox\")", | |
| "nextLink":"//span[@class=\"page\"]/span/following-sibling::a|//span[@class=\"next\"]/a|id(\"mangaBottomBox\")/ul/li[@class=\"prev\"]/a", | |
| "wedata.net.id":55512 | |
| }, | |
| { | |
| "url":"^http://pckles\\.com/", | |
| "pageElement":"//ul[@class='moreimage']/li", | |
| "nextLink":"//p[@class='textcenter']/a[@class='right']", | |
| "wedata.net.id":38270 | |
| }, | |
| { | |
| "url":"^http://freejav\\.us/", | |
| "pageElement":"//div[@id=\"channels\"]", | |
| "nextLink":"//a[(text()=\"»»\")]", | |
| "wedata.net.id":77852 | |
| }, | |
| { | |
| "url":"^http://taisy0\\.com/", | |
| "pageElement":"//a[@class=\"archive-item__link\"]", | |
| "nextLink":"//link[@rel=\"next\"]", | |
| "wedata.net.id":62500 | |
| }, | |
| { | |
| "url":"^http://4travel\\.jp/", | |
| "pageElement":"//ul[@class='user_bbs_list' or @class='summary_list_box']/li|//div[@class='travelogue_each']/p[@class='txt_report']/preceding-sibling::*", | |
| "nextLink":"//*[@class='next' or @class='unit_img01 prev']/a", | |
| "wedata.net.id":2057 | |
| }, | |
| { | |
| "url":"^http://bizzine\\.jp/", | |
| "pageElement":"//section[@itemprop='articleSection'][last()]", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":76975 | |
| }, | |
| { | |
| "url":"^http://kakaku\\.com/", | |
| "pageElement":"//div[@class='searchResultCase clearfix']", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":64250 | |
| }, | |
| { | |
| "url":"^http://dogatch\\.jp/", | |
| "pageElement":"//div[@class='text']/p|//div[@class='pic']", | |
| "nextLink":"//li[@class='right']/a", | |
| "wedata.net.id":76433 | |
| }, | |
| { | |
| "url":"^http://ameblo\\.jp/.", | |
| "insertBefore":"//div[contains(@id, \"footer_ad\")]", | |
| "pageElement":"(id(\"sub_main\")|id(\"sub_main\")/*)/div[contains(concat(\" \",@class,\" \"), \" entry \") or @id=\"comment_module\" or @id=\"recent_entries_list\" or @id=\"trackback\" or contains(@class,\"trackbackPaging\") or contains(@class,\"commentPaging\")]|//*[article]/*[self::article or self::aside]", | |
| "nextLink":"(id(\"sub_main\")|id(\"sub_main\")/*)/div[contains(concat(\" \",@class,\" \"),\" page \")]//a[@class=\"nextPage\"]|id(\"keyJumpNav\")/li[2]/a[@class=\"skinBlock\" and contains(text(), \"次\")]", | |
| "wedata.net.id":715 | |
| }, | |
| { | |
| "url":"^http://synodos\\.jp/", | |
| "pageElement":"id(\"singleInner\")/*", | |
| "nextLink":"id(\"linkPagesArrowBg\")/a[span[@class=\"linkPagesArrowNext\"]]", | |
| "wedata.net.id":72752 | |
| }, | |
| { | |
| "url":"^http://diamond\\.jp/", | |
| "pageElement":"//div[contains(@id,'category-list')]//li", | |
| "nextLink":"//div[@class='next_p']/a", | |
| "wedata.net.id":41166 | |
| }, | |
| { | |
| "url":"^http://2525fx\\.com/", | |
| "pageElement":"id('content')/div[@class]", | |
| "nextLink":"//p[@class=\"pagenavi\"]/a[last()][not(@href=\"http://2525fx.com/\")]", | |
| "wedata.net.id":79955 | |
| }, | |
| { | |
| "url":"^http://ddnavi\\.com/", | |
| "pageElement":"id('article_body archive_list')/*", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":55745 | |
| }, | |
| { | |
| "url":"^https://exelab\\.ru/", | |
| "pageElement":"//table[@class='forums']/tbody/tr[td[@colspan='2' or @width='50%']]/following-sibling::tr", | |
| "nextLink":"//span[@class=\"txtSm\"]/b[count(./a)>1]/b/following-sibling::a[1]", | |
| "wedata.net.id":77437 | |
| }, | |
| { | |
| "url":"^http://eiga\\.com/.+", | |
| "pageElement":"//dl[@class='newsList']/*|//div[@class='newBox']", | |
| "nextLink":"//a[@rel='next' or ../@class='daybefore']", | |
| "wedata.net.id":1645 | |
| }, | |
| { | |
| "url":"^https?://rarbg\\.to/", | |
| "pageElement":"//tr[@class='lista2']", | |
| "nextLink":"//a[@title='next page']", | |
| "wedata.net.id":77608 | |
| }, | |
| { | |
| "url":"^http://likes\\.com/.", | |
| "pageElement":"//div[@class='main_image_content']/div", | |
| "nextLink":"id('bottom_next_button')", | |
| "wedata.net.id":80827 | |
| }, | |
| { | |
| "url":"^http://h2porn\\.com/", | |
| "pageElement":"//section[@class=\"thumbs\"]", | |
| "nextLink":"//a[@class=\"next\"]", | |
| "wedata.net.id":57129 | |
| }, | |
| { | |
| "url":"^http://incezt\\.net/", | |
| "pageElement":"id(\"content\")", | |
| "nextLink":"//li[@class='rarr']/a", | |
| "wedata.net.id":66600 | |
| }, | |
| { | |
| "url":"^http://am-our\\.com/", | |
| "pageElement":"id(\"articleContent\")/*|id(\"articleHeader\")|//div[@class=\"newEntryList\" or @class=\"spBacknumberList\"]", | |
| "nextLink":"//td[@class=\"prev\"]/a|id(\"paging\")//li[./span]/following-sibling::li[1]/a", | |
| "wedata.net.id":65156 | |
| }, | |
| { | |
| "url":"^http://imlive\\.com/", | |
| "pageElement":"//*[@id=\"ContentContainer\"]/div/div[@class=\"main_container\"] | //*[@id=\"BodyContainer\"]/div/div[@class=\"gallery\" or @class=\"list\" or @class=\"tiles\"]", | |
| "nextLink":"//span[@class=\\\"pager below\\\"]/a[last()] | //a[contains(concat(\" \", @class, \" \"), \"nextHosts\")]", | |
| "wedata.net.id":77473 | |
| }, | |
| { | |
| "url":"^http://gqjapan\\.jp/", | |
| "pageElement":"//article[@class='article_box']/*[self::p[(text() or img or br/parent::p/preceding-sibling::p) and not(@class='credit')] or self::div]|id('mdl_articles')//article", | |
| "nextLink":"//div[@class='next' or @class='next link_img']/a", | |
| "wedata.net.id":55336 | |
| }, | |
| { | |
| "url":"^http://nuzzel\\.com/", | |
| "pageElement":"//div[@class='list-group-item']", | |
| "nextLink":"//footer[@class='more-results']/a", | |
| "wedata.net.id":77327 | |
| }, | |
| { | |
| "url":"^https?://calil\\.jp/", | |
| "pageElement":"id('info_bar')/following-sibling::ul/li|//div[contains(concat(' ', @class, ' '), ' recipe_list_box ')]/*[contains(concat(' ', @class, ' '), ' prefix ')]/li", | |
| "nextLink":"//div[contains(concat(' ', @class, ' '), ' pagination ')]//li[@class='active']/following-sibling::li[1]/a", | |
| "wedata.net.id":43381 | |
| }, | |
| { | |
| "url":"^http://shogi1\\.com/", | |
| "pageElement":"id(\"list\")/div|id(\"sns-group\")/preceding-sibling::node()|id(\"comment-area\")/*", | |
| "nextLink":"//li[@class=\"next\"]/a|//div[@class=\"prev\"]/a", | |
| "wedata.net.id":77041 | |
| }, | |
| { | |
| "url":"^http://octoba\\.net/", | |
| "pageElement":"//div[@class='appbox clearfix']", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":35664 | |
| }, | |
| { | |
| "url":"http://justjavhd.com/", | |
| "pageElement":"//main[@id=\"main\"]", | |
| "nextLink":"//a[@class=\"next page-numbers\"]", | |
| "wedata.net.id":77489 | |
| }, | |
| { | |
| "url":"^http://wedata\\.net/", | |
| "pageElement":"//li[starts-with(@class,'hentry')]|id('content')/node()[table or p or self::text()[last()]][not(//li[contains(@class, 'hentry')])]|id('content')/ul[@class='history']/li[(count(a)=1 and contains(a/@href,'users')) or (count(a)=0 and starts-with(.,'Delete'))]/node()", | |
| "nextLink":"//a[@rel='next']|id('content')/ul[@class='history']/li[(count(a)=1 and contains(a/@href,'users')) or (count(a)=0 and starts-with(.,'Delete'))]/following-sibling::li/a[contains(@href,'items')]", | |
| "wedata.net.id":66829 | |
| }, | |
| { | |
| "url":"^http://yutaka\\.net/", | |
| "pageElement":"id('cols')", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":55249 | |
| }, | |
| { | |
| "url":"^http://cc\\.x0\\.to/", | |
| "pageElement":"//table[.//span[@class=\"SY\"]]|//tr[contains(@class,\"GYO1\") or contains(@class,\"GYO2\")]", | |
| "nextLink":"//table[.//span[@class=\"SY\"]]/following-sibling::div[@align=\"CENTER\"]//td[last()]/a|//b[@class=\"C4\"]/center[count(./a)>1 or //a[@href=\"./?id=1\"] or not(//a[@href=\"p/1.html\"])]/a[last()]|//a[./span[@class=\"P2\"]]/following-sibling::a[1]|id(\"hyo\")[not(.//a[@href=\"./bbs.php?top=free&mode=kizi&no=1\"])]/following-sibling::div[@align=\"CENTER\"]/a[last()]", | |
| "wedata.net.id":77221 | |
| }, | |
| { | |
| "url":"^https?://lobste\\.rs", | |
| "pageElement":"id('inside')//li", | |
| "nextLink":"//div[@class='morelink']/a[last()]", | |
| "wedata.net.id":74530 | |
| }, | |
| { | |
| "url":"^http://javhub\\.net/", | |
| "pageElement":"//div[@class=\"custom-pagination text-center\"]/preceding-sibling::node()", | |
| "nextLink":"//a[(text()=\"Next\")]", | |
| "wedata.net.id":80655 | |
| }, | |
| { | |
| "url":"^http://pix2ch\\.net/", | |
| "pageElement":"id(\"canvas\")/div[@class=\"thread\"]", | |
| "nextLink":"id(\"pagenav\")/a[contains(.,\"»\")]", | |
| "wedata.net.id":56872 | |
| }, | |
| { | |
| "url":"^http://twitxr\\.com/", | |
| "pageElement":"//div[@class=\"div_update\"]", | |
| "nextLink":"id(\"divTipBody\")/descendant::a[contains(., \"\u00bb\")][last()]", | |
| "wedata.net.id":556 | |
| }, | |
| { | |
| "url":"^http://jpfiles\\.eu/", | |
| "pageElement":"//div[starts-with(@id,'post-')]", | |
| "nextLink":"id('pagination')[count(./a)>1 or ./a[contains(@href,'/page/2/')]]/a[last()]", | |
| "wedata.net.id":73896 | |
| }, | |
| { | |
| "url":"^https?://eking\\.jp/", | |
| "pageElement":"//div[@class='main_column']/div[@class='list_area03' or @style='clear:both;']", | |
| "nextLink":"//li[@class='current']/following-sibling::li[1]/a", | |
| "wedata.net.id":77084 | |
| }, | |
| { | |
| "url":"^http://stylebot\\.me", | |
| "pageElement":"//div[@class='row style-group']", | |
| "nextLink":"//div[@class='pagination']/a[text()='Next']", | |
| "wedata.net.id":73908 | |
| }, | |
| { | |
| "url":"^http://getnews\\.jp/", | |
| "pageElement":"//ul[@class='article-list']/li", | |
| "nextLink":"//a[@class='next page-numbers']", | |
| "wedata.net.id":74797 | |
| }, | |
| { | |
| "url":"^http://touchlab\\.jp", | |
| "pageElement":"//div[div[@class='item-details']//img]", | |
| "nextLink":"//a[i/@class='td-icon-menu-right']", | |
| "wedata.net.id":2138 | |
| }, | |
| { | |
| "url":"^http://javfree\\.me/", | |
| "pageElement":"//ul[@class=\"hfeed posts-default clearfix\"]", | |
| "nextLink":"//a[@class=\"nextpostslink\"]", | |
| "wedata.net.id":80988 | |
| }, | |
| { | |
| "url":"^http://reason\\.com/", | |
| "pageElement":"//section[@class='resultlist']/article|//div[@class='entry postcontent']/*[not(starts-with(@id,'promo'))]", | |
| "nextLink":"//a[@rel='next' or ../@class='archiveslink ']", | |
| "wedata.net.id":76253 | |
| }, | |
| { | |
| "url":"^http://rusdate\\.net", | |
| "pageElement":"//*[@class=\"mainTableRightTdDiv\"]//*[@class=\"mainUsersPic\"]", | |
| "nextLink":"//*[@class=\"next_prev\"]/span[last()]/a", | |
| "wedata.net.id":77234 | |
| }, | |
| { | |
| "url":"^http://breakr\\.net/", | |
| "pageElement":"//div[contains(concat(\" \", @class, \" \"), \" article \")]", | |
| "nextLink":"//a[contains(concat(\" \", @class, \" \"), \" next_page \")]", | |
| "wedata.net.id":2173 | |
| }, | |
| { | |
| "url":"^http://pshero\\.com/", | |
| "pageElement":"//div[@class=\"mini_post_item\"]", | |
| "nextLink":"//a[@class=\"nextpostslink\"]", | |
| "wedata.net.id":1867 | |
| }, | |
| { | |
| "url":"^http://ow\\.ly/user/", | |
| "pageElement":"//article", | |
| "nextLink":"//a[@class='-next']", | |
| "wedata.net.id":61830 | |
| }, | |
| { | |
| "url":"^http://calamel\\.jp/", | |
| "pageElement":"//li[@class='itemlist']", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":27753 | |
| }, | |
| { | |
| "url":"^http://booklog\\.jp/", | |
| "pageElement":"//div[@class=\"favoriteUser clearFix\"]|//ul[@class=\"quotes\"]|//li[@class=\"questionList\"]|//div[@class=\"t10M posR clearFix\"]|//div[@id=\"timeline\"]/div[@id=\"timeline\"]", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":77514 | |
| }, | |
| { | |
| "url":"^https://500px\\.com/", | |
| "pageElement":"//div[@class='photos clearfix']/a", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":39369 | |
| }, | |
| { | |
| "url":"^https://retrip\\.jp/", | |
| "pageElement":"//section[@class='expBottomGridList']/ul/li|//article/*", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":77125 | |
| }, | |
| { | |
| "url":"^http://twinavi\\.jp/", | |
| "pageElement":"//div[@class='section-body-sub']/ul/li[starts-with(@class,'lined list-xl')]|id(\"article\")/hr/following-sibling::node()", | |
| "nextLink":"//a[@rel=\"next\"]|//li[@class=\"pagecommand\"]/a[contains(text(),\"次\")]", | |
| "wedata.net.id":61443 | |
| }, | |
| { | |
| "url":"^http://pix2ch\\.net/", | |
| "pageElement":"id(\"main\")/article", | |
| "nextLink":"id(\"pagenav\")/div[last()]/a", | |
| "wedata.net.id":72745 | |
| }, | |
| { | |
| "url":"news\\.goo\\.ne\\.jp", | |
| "pageElement":"//div[@class=\"article-thumbs\"]|//div[@class=\"article-text\"]", | |
| "nextLink":"//li[@class=\"pager-next\"]/a", | |
| "wedata.net.id":80771 | |
| }, | |
| { | |
| "url":"^http://laughy\\.jp/", | |
| "pageElement":"//section[@class='pickup_section column490']/div[@class='post'] | //article[@class='main_post']/*[following-sibling::div/@id='inview_paging']", | |
| "nextLink":"//div[starts-with(@class,'paging')]//li[span]/following-sibling::li[1]/a", | |
| "wedata.net.id":77314 | |
| }, | |
| { | |
| "url":"^http://togech\\.jp/", | |
| "pageElement":"//ul[@class=\"page-nav\"]/preceding-sibling::node()[not(./ul[@class=\"side_link_box\"])][not(./div[@class=\"message_box\"])]|//article[@id=\"article_main\"][not(//div[@class=\"page-link\"])]|//section[@class=\"entry-content\"]", | |
| "nextLink":"id(\"contents\")//li[@class=\"next\"]/a|id(\"contents\")/div[@class=\"navigation_box navigation_button clearfix\"]/a[1]|//div[@class=\"page-link\"]/span/following-sibling::a[1]", | |
| "wedata.net.id":74798 | |
| }, | |
| { | |
| "url":"^http://nymag\\.com/", | |
| "pageElement":"id(\"story\")", | |
| "nextLink":"//li[@class=\"next\"]/a", | |
| "wedata.net.id":2689 | |
| }, | |
| { | |
| "url":"^http://drawr\\.net/", | |
| "pageElement":"id(\"content\")", | |
| "nextLink":"(//li[@class=\"left-food-link\"])[last()]/a", | |
| "wedata.net.id":27655 | |
| }, | |
| { | |
| "url":"^http://oglaf\\.com/", | |
| "pageElement":"//div[@class=\"content\"]", | |
| "nextLink":"id(\"nx\")/parent::a", | |
| "wedata.net.id":46524 | |
| }, | |
| { | |
| "url":"^http://cyblog\\.jp/", | |
| "pageElement":"id('content')/*[preceding-sibling::br[1]][following-sibling::p[last()]]", | |
| "nextLink":"id('content')//a[u='»' or contains(u,'前のエントリ')]", | |
| "wedata.net.id":1861 | |
| }, | |
| { | |
| "url":"^http://bokete\\.jp/", | |
| "pageElement":"//div[@class=\"boke\"]/*[not(@class=\"boke-meta\")]|//div[@class=\"boke-meta\"]/*[not(@class=\"boke-information-row\")]", | |
| "nextLink":"//link[@rel=\"next\"]", | |
| "wedata.net.id":31877 | |
| }, | |
| { | |
| "url":"^http://identi\\.ca/", | |
| "pageElement":"id(\"notices_primary\")//*[contains(concat(\" \", normalize-space(@class), \" \"), \" notices \")]", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":1919 | |
| }, | |
| { | |
| "url":"^http://2nyan\\.org/", | |
| "pageElement":"//div[@class='autopagerize_page_element']/*", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":77665 | |
| }, | |
| { | |
| "url":"^http://maijar\\.jp/", | |
| "pageElement":"id(\"main\")/div[@class=\"tabs\"]/following-sibling::node()[following-sibling::div[@class=\"pager\"]]", | |
| "nextLink":"//div[@class=\"pager\"]/span[@class=\"pager-list\"]/strong[@class=\"pager-current\"]/following-sibling::a", | |
| "wedata.net.id":64964 | |
| }, | |
| { | |
| "url":"^http://koebu\\.com/", | |
| "pageElement":"//div[@class='boxPager group'][1]/following-sibling::*[ following::div/@class='boxPager group']/*", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":45686 | |
| }, | |
| { | |
| "url":"^https?://halol\\.me", | |
| "pageElement":"//div[@class=\"list-group articles-lg\"]/div[@class=\"clearfix paginate\"]/preceding-sibling::*[not(self::h2)]", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":76991 | |
| }, | |
| { | |
| "url":"http://kabutan\\.jp/", | |
| "pageElement":"//table[@class='stock_table']/tbody/tr", | |
| "nextLink":"//a[contains(text(), '次へ')]", | |
| "wedata.net.id":76494 | |
| }, | |
| { | |
| "url":"^https?://type\\.jp/", | |
| "pageElement":"//article[@class='mod-Job-info']", | |
| "nextLink":"//p[@class='next active']/a", | |
| "wedata.net.id":64710 | |
| }, | |
| { | |
| "url":"^https?://cyta\\.jp/", | |
| "pageElement":"//div[@class=\"result\"]", | |
| "nextLink":"id(\"search-pager\")/span[@class=\"item\"][last()-1]/a[not(contains(@href,\"&page=1\"))]", | |
| "wedata.net.id":29951 | |
| }, | |
| { | |
| "url":"^http://kanpoo\\.jp/", | |
| "pageElement":"//div[starts-with(@class,'bg')]|//table[@class='topics']", | |
| "nextLink":"//a[contains(.,'>>') or contains(.,'<')][@href]", | |
| "wedata.net.id":31659 | |
| }, | |
| { | |
| "url":"^http://hissi\\.org/", | |
| "pageElement":"//a[.='<<前へ' or .='次へ>>'][1]/following-sibling::table//table//tr[td]", | |
| "nextLink":"//a[.='次へ>>'][1]", | |
| "wedata.net.id":2747 | |
| }, | |
| { | |
| "url":"^http://otapol\\.jp/", | |
| "pageElement":"//div[@class='offset1']", | |
| "nextLink":"//li[@class='next']/a", | |
| "wedata.net.id":76349 | |
| }, | |
| { | |
| "url":"^http://excnn\\.com/", | |
| "pageElement":"id('dle-content')/div[.//@id='post-img']", | |
| "nextLink":"//a[img/@alt='Next']", | |
| "wedata.net.id":76377 | |
| }, | |
| { | |
| "url":"^http://dova-s\\.jp/", | |
| "pageElement":"id('itemList')/dl", | |
| "nextLink":"id('numbers')/li[span]/following-sibling::li[1]/a", | |
| "wedata.net.id":76230 | |
| }, | |
| { | |
| "url":"^http://2ch-c\\.net/", | |
| "pageElement":"//tr[@ei]", | |
| "nextLink":"//div[@class='button_area']/a[contains(.,'前の')]", | |
| "wedata.net.id":55575 | |
| }, | |
| { | |
| "url":"^http://hpjav\\.com/", | |
| "pageElement":"//div[@class=\"category-count\"]/following-sibling::*[following::div[@class=\"models-page-box\"]]", | |
| "nextLink":"//a[contains(span[1]/text(),\"»\")]", | |
| "wedata.net.id":80985 | |
| }, | |
| { | |
| "url":"^http://hypem\\.com/", | |
| "pageElement":"id('track-list')/div[starts-with(@id,'section')]", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":25823 | |
| }, | |
| { | |
| "url":"^http://songle\\.jp/", | |
| "pageElement":"//div[@class='content']/*[@class='songlist' or @class='artists' or @class='playlists' or @class='edits']//*[self::li or starts-with(@class,'song clearfix')]", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":74901 | |
| }, | |
| { | |
| "url":"^http://reroom\\.jp/", | |
| "pageElement":"id(\"main\")/div[contains(concat(\" \", @class, \" \"), \" thumbnail \")]", | |
| "nextLink":"id(\"main\")/div[@class=\"paginator\"]//a[@class=\"next\"]", | |
| "wedata.net.id":38779 | |
| }, | |
| { | |
| "url":"^http://spsoku\\.com", | |
| "pageElement":"id('page-front')/section/section", | |
| "nextLink":"//div[@class=\"pagenation\"]/ul/li[@class=\"next\"]/a", | |
| "wedata.net.id":80953 | |
| }, | |
| { | |
| "url":"^http://megacams.me/", | |
| "pageElement":"//div[@class='thumbs']/div[@class='th']", | |
| "nextLink":"//i[@class='ico_next']/parent::a", | |
| "wedata.net.id":77333 | |
| }, | |
| { | |
| "url":"^http://diply\\.com/", | |
| "pageElement":"//article[@class='article-body']", | |
| "nextLink":"//li[@class='active-pg']/following-sibling::li[1]/a", | |
| "wedata.net.id":74918 | |
| }, | |
| { | |
| "url":"^http://dx4jp\\.com/", | |
| "pageElement":"//div[@class='list-product' or @class='pods-box']", | |
| "nextLink":"//a[@class=\"next page-numbers\"]", | |
| "wedata.net.id":65721 | |
| }, | |
| { | |
| "url":"^http://ejohn\\.org/", | |
| "pageElement":"id('body')/div[@class='wrap']/*[preceding-sibling::h2][following-sibling::br[last()]]", | |
| "nextLink":"//a[.='« Previous entries']", | |
| "wedata.net.id":1555 | |
| }, | |
| { | |
| "url":"^http://d-upp\\.com/", | |
| "pageElement":"//div[@id=\"main\"]/section[@class=\"date\"]/ul[@class=\"file_list\"]", | |
| "nextLink":"//div[@id=\"main\"]//a[@class=\"next page-numbers\"]", | |
| "wedata.net.id":80761 | |
| }, | |
| { | |
| "url":"^http://favim\\.com/", | |
| "pageElement":"id('images-block-grid')/li", | |
| "nextLink":"//a[@class='next button blue-style']", | |
| "wedata.net.id":59220 | |
| }, | |
| { | |
| "url":"^http://nukos\\.net/", | |
| "pageElement":"id('contents')/ul[@class='pola']/li|id('form')", | |
| "nextLink":"//a[starts-with(.,'[次の')]", | |
| "wedata.net.id":53675 | |
| }, | |
| { | |
| "url":"http://bbs.hupu.com/", | |
| "pageElement":"//div[@class='floor']", | |
| "nextLink":"//a[@class='next']", | |
| "wedata.net.id":77073 | |
| }, | |
| { | |
| "url":"^http://rlsbb\\.com/", | |
| "pageElement":"//div[@class='entry post']", | |
| "nextLink":"//a[(text()='Older Entries')]", | |
| "wedata.net.id":80941 | |
| }, | |
| { | |
| "url":"^https://jspp\\.org/", | |
| "pageElement":"//section[@class='q' or @class='a']|id('main')/table/tbody/tr", | |
| "nextLink":"//a[../@class='next arrow' or @class='next']", | |
| "wedata.net.id":77072 | |
| }, | |
| { | |
| "url":"^http://tocana\\.jp/", | |
| "pageElement":"id(\"entryBody\")/*[//meta[@property=\"og:url\"][contains(@content,\"post\")]]|id(\"pageNav\")/preceding-sibling::*[not(@id=\"categoryTitle\")][//meta[@property=\"og:url\"][not(contains(@content,\"post\"))]]", | |
| "nextLink":"id(\"pageNav\")/ul/li[@class=\"next\"]/a", | |
| "wedata.net.id":74812 | |
| }, | |
| { | |
| "url":"^http://jpddl\\.com/", | |
| "pageElement":"//div[@class='panel panel-default']", | |
| "nextLink":"//a[contains(.,'Next')]", | |
| "wedata.net.id":63155 | |
| }, | |
| { | |
| "url":"^http://tower\\.jp/", | |
| "pageElement":"//table[@class='chartTbl']|//table[@class='tableModel-recBase1' or @class='nmnlPosterArchiveTbl']/tbody/tr", | |
| "nextLink":"//p[@class='nextLink']/a|//ul[@class='inMdl-chartListSub']/li[a[contains(.,substring(//th[@class='subHead']/text(),1,10))]]/following-sibling::li[1]/arn", | |
| "wedata.net.id":76300 | |
| }, | |
| { | |
| "url":"^http://m-hz\\.net/", | |
| "pageElement":"id('item')/*", | |
| "nextLink":"//a[contains(.,'次のページ')]", | |
| "wedata.net.id":66320 | |
| }, | |
| { | |
| "url":"^http://spora\\.jp/", | |
| "pageElement":"//div[@class='post-wrap']", | |
| "nextLink":"//div[@class='pagerRelative']/b[not(a)]/following-sibling::b[1]/a", | |
| "wedata.net.id":54187 | |
| }, | |
| { | |
| "url":"^http://slib\\.net/", | |
| "pageElement":"//div[@class='contents-list-works' or @class='contents-list-authors' or @class='contents-author-list']/*", | |
| "nextLink":"//ul[@class='pagination']/li[not(a/@href)]/following-sibling::li[1]/a", | |
| "wedata.net.id":76898 | |
| }, | |
| { | |
| "url":"^http://osada\\.us/", | |
| "pageElement":"//article/header|//div[@class=\"article__content entry-content e-content\"]", | |
| "nextLink":"//a[@rel=\"prev\"]", | |
| "wedata.net.id":1768 | |
| }, | |
| { | |
| "url":"^http://1470\\.net/", | |
| "pageElement":"//article", | |
| "nextLink":"//link[@rel=\"prev\"]|//a[@class=\"next page-numbers\"]", | |
| "wedata.net.id":77843 | |
| }, | |
| { | |
| "url":"^http://udama\\.jp/", | |
| "pageElement":"id(\"content-inner\")/section", | |
| "nextLink":"//a[@rel=\"prev\"]", | |
| "wedata.net.id":77674 | |
| }, | |
| { | |
| "url":"^http://notiz\\.jp/", | |
| "insertBefore":"//div[@class=\"page-links\"]", | |
| "pageElement":"//div[@class=\"contents-body\"]/div[@class=\"section\"]", | |
| "nextLink":"//div[@class=\"page-links\"]/p/a[last()]", | |
| "wedata.net.id":38823 | |
| }, | |
| { | |
| "url":"^http://fixia\\.jp/", | |
| "pageElement":"//div[@class=\"content\"]/*", | |
| "nextLink":"//span[@class=\"current\"]/following-sibling::span/a", | |
| "wedata.net.id":77218 | |
| }, | |
| { | |
| "url":"^http://m2ch\\.net/", | |
| "pageElement":"id('page-container')/div", | |
| "nextLink":"//a[@rel='prev']", | |
| "wedata.net.id":72751 | |
| }, | |
| { | |
| "url":"^http://duga\\.jp/.", | |
| "pageElement":"id(\"searchresultarea\")/div[@class=\"contentsbox\"]/div", | |
| "nextLink":"//ul[@class=\"paginglist\"]/li[span]/following-sibling::li/a", | |
| "wedata.net.id":27501 | |
| }, | |
| { | |
| "url":"^http://tueee\\.net", | |
| "pageElement":"id(\"main\")/article", | |
| "nextLink":"//ul[@class=\"main_navi\"]/li[span]/following-sibling::li/a", | |
| "wedata.net.id":79972 | |
| }, | |
| { | |
| "url":"^http://84ism\\.jp/", | |
| "pageElement":"//a[starts-with(@id,'post-')]", | |
| "nextLink":"//div[@class='alignleft']/a", | |
| "wedata.net.id":55195 | |
| }, | |
| { | |
| "url":"^http://fjord\\.jp/", | |
| "pageElement":"id(\"main\")/div[contains(concat(\" \", @class, \" \"), \" hentry \")]", | |
| "nextLink":"//a[@class=\"nextpostslink\"]|//link[@rel=\"prev\"]", | |
| "wedata.net.id":33498 | |
| }, | |
| { | |
| "url":"^http://doope\\.jp/", | |
| "pageElement":"//div[@class=\"cont_box\"]", | |
| "nextLink":"//a[@class=\"nextpostslink\"]", | |
| "wedata.net.id":65170 | |
| }, | |
| { | |
| "url":"^http://xcity\\.jp/", | |
| "pageElement":"//div[@class=\"itemBox\"] | //table[@class=\"list\" or @class=\"resultList\" or @class=\"otherRank\"]", | |
| "nextLink":"//li[@class=\"next\"]/a[@class=\"rest-page-item\"] | id(\"order\")/li[not(@class)]/following-sibling::li/a", | |
| "wedata.net.id":33689 | |
| }, | |
| { | |
| "url":"^https://eztv\\.ag/", | |
| "pageElement":"//table[.//tr[@name=\"hover\"][@class=\"forum_header_border\"]]//tr[@class]", | |
| "nextLink":"//td[@align=\"right\"]/a", | |
| "wedata.net.id":30441 | |
| }, | |
| { | |
| "url":"^http://logmi\\.jp/", | |
| "pageElement":"//ul[@class='common-log-list'][//a/@rel='next']/li|id('popup-end')/preceding-sibling::*|//p[@class='outline']|id('article-title')", | |
| "nextLink":"//a[@rel=\"next\" or @class=\"lead-next\"]", | |
| "wedata.net.id":74687 | |
| }, | |
| { | |
| "url":"^http://qoly\\.jp/", | |
| "pageElement":"//div[@class='post-inner']//*[@class='post-block-small' or @class='post clearfix']", | |
| "nextLink":"//li[@class='pagination-next' or @class='next']/a", | |
| "wedata.net.id":74839 | |
| }, | |
| { | |
| "url":"^http://srad\\.jp/", | |
| "pageElement":"id('firehoselist')/*", | |
| "nextLink":"//li[@class='fleft selected']/a", | |
| "wedata.net.id":721 | |
| }, | |
| { | |
| "url":"^http://type\\.jp/", | |
| "pageElement":"//div[@class=\"page-link\"]/preceding-sibling::*|id(\"category\")//article[@class=\"card\"]|id(\"single_post\")", | |
| "nextLink":"//link[@rel=\"next\"]|//li[@class=\"next\"]/a", | |
| "wedata.net.id":55808 | |
| }, | |
| { | |
| "url":"^http://smcb\\.jp/", | |
| "pageElement":"(id('column2leftColumn')|//div[@class='result_list'])/div/ul/li|//div[@class='newDiaryList' or @class='photoList']//tr|//table[@class='listing']", | |
| "nextLink":"//link[@rel='next']", | |
| "wedata.net.id":29281 | |
| }, | |
| { | |
| "url":"^http://thetv\\.jp", | |
| "pageElement":"//div[@class='contents']/dl", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":56888 | |
| }, | |
| { | |
| "url":"^http://mdpr\\.jp/", | |
| "pageElement":"//figure[img/@class='outputthumb']|//div[@class='main-list']/ul/li", | |
| "nextLink":"//link[@rel='next']|//a[@class='pure-button ext']", | |
| "wedata.net.id":75008 | |
| }, | |
| { | |
| "url":"^http://mery\\.jp/", | |
| "pageElement":"id(\"content\")/div[contains(@class,\"article_list\")]/div[not(@id)]|//ul[@class=\"other_keyword_list clearfix\"]/li|//h1[@class=\"title_all_topics\"]/following-sibling::*[following-sibling::div[@id]]", | |
| "nextLink":"//a[@rel='next']", | |
| "wedata.net.id":76724 | |
| }, | |
| { | |
| "url":"^http://n4g\\.com/", | |
| "pageElement":"//div[@class='sl-item']|//div[starts-with(@id, 'nl-i')]|//table[@class='gridlist rowhovering']//tr[td]", | |
| "nextLink":"//a[@class='nextpager-next' or @class='next']", | |
| "wedata.net.id":32369 | |
| }, | |
| { | |
| "url":"^http://inyo\\.jp/", | |
| "pageElement":"id(\"quotes\")/div[contains(@class,\"quote\") and not(.//*[@class=\"paging-big\"])]", | |
| "nextLink":"id(\"paging-next\")", | |
| "wedata.net.id":1237 | |
| }, | |
| { | |
| "url":"^http://jpon\\.us/", | |
| "pageElement":"//div[@class='page_navi clearfix']/preceding-sibling::*", | |
| "nextLink":"//a[@class='next page-numbers']", | |
| "wedata.net.id":72749 | |
| }, | |
| { | |
| "url":"^http://wwd\\.com/", | |
| "pageElement":"//div[@class='subcategory-landing-touts']/*", | |
| "nextLink":"id('page-arrow-next')/a", | |
| "wedata.net.id":76924 | |
| }, | |
| { | |
| "url":"^http://bash\\.im/", | |
| "pageElement":"//div[@class='quote'][not(id('the_strip'))]|id('the_strip')", | |
| "nextLink":"//a[.='←']|//span[@class='current']/following-sibling::a[1]", | |
| "wedata.net.id":31617 | |
| }, | |
| { | |
| "url":"^http://3ost\\.ru/", | |
| "pageElement":"//div[@class='cb-box' or @class='h-c']", | |
| "nextLink":"//div[@class='navigation']/span[number()>0]/following-sibling::a[1]", | |
| "wedata.net.id":77202 | |
| }, | |
| { | |
| "url":"^http://miau\\.jp/", | |
| "pageElement":"id(\"main\")/*", | |
| "nextLink":"//a[@accesskey=\"n\"]", | |
| "wedata.net.id":502 | |
| }, | |
| { | |
| "url":"^http://vobo\\.jp/", | |
| "pageElement":"//a[contains(.,\"<<前に戻る\") or contains(.,\"次を読む>>\")]/ancestor::div[@class=\"col-1\"]", | |
| "nextLink":"//a[contains(.,\"次を読む>>\")]", | |
| "wedata.net.id":63637 | |
| }, | |
| { | |
| "url":"^http://cwer\\.ws/", | |
| "pageElement":"//div[@class='node']", | |
| "nextLink":"//div[@class='paginator']//td[span/strong]/following-sibling::td[1]//a", | |
| "wedata.net.id":77133 | |
| }, | |
| { | |
| "url":"^http://mblg\\.tv/", | |
| "pageElement":"(//table[@class='selector']|id('rankList'))//tr|//dl[@class='miniList']/*|//div[@class='boxcontent']/*[preceding-sibling::div/@class='pm clear'][following-sibling::div/@class='pm clear']|id('articles')/div[@class='article']", | |
| "nextLink":"//a[@class='fs_page fs_next' or @accesskey=\"#\"]", | |
| "wedata.net.id":33750 | |
| }, | |
| { | |
| "url":"^http://hbol\\.jp/", | |
| "pageElement":"//div[@class=\"post-next-page\"]/preceding-sibling::node()|//div[@class=\"post-pager-box\"][not(//div[@class=\"post-next-page\"])]/preceding-sibling::node()|//div[@class=\"article-list\"]|//div[@class=\"article-list\"]/following-sibling::div[1]", | |
| "nextLink":"//div[@class='post-next-page']/a|//li[@class='pager-text'][last()]/a", | |
| "wedata.net.id":77786 | |
| }, | |
| { | |
| "url":"^http://honz\\.jp/", | |
| "pageElement":"id('article_body')|id('signage')[div/@class='category']|id('list_content')//li", | |
| "nextLink":"//a[(.|..)/@class='next']", | |
| "wedata.net.id":74989 | |
| }, | |
| { | |
| "url":"^http://jmty\\.jp/", | |
| "pageElement":"id(\"articles_main_list\")/ul/li", | |
| "nextLink":"//a[@rel=\"next\"]", | |
| "wedata.net.id":77503 | |
| }, | |
| { | |
| "url":"javplatform\\.com", | |
| "pageElement":"id('content')", | |
| "nextLink":"//nav[@class='pagination']/span[@class='current']/following-sibling::a", | |
| "wedata.net.id":77832 | |
| }, | |
| { | |
| "url":"http://camddl.ws/", | |
| "pageElement":"//*[@id=\"theposts\"]/li", | |
| "nextLink":"//div[@class=\"pager\"]/ul/li/span[@class=\"current\"]/parent::node()/following-sibling::li[1]/a", | |
| "wedata.net.id":77522 | |
| }, | |
| { | |
| "url":"^http://tu\\.tv/", | |
| "pageElement":"//table[@class=\"rejillavideos\" or @class=\"listado_videos\"]|id(\"rankinglist rankingblog\")", | |
| "nextLink":"id(\"actual\")/following-sibling::li[1]/a", | |
| "wedata.net.id":28938 | |
| }, | |
| { | |
| "url":"http://.*bgen.or", | |
| "pageElement":"//table[@class=\"c\"]", | |
| "nextLink":"//a[@id=\"nextlink2\"]", | |
| "wedata.net.id":65556 | |
| }, | |
| { | |
| "url":"^http://.*bbs.*/", | |
| "pageElement":"(//form|//table)[.//input[@checked]]/following-sibling::*[following::small]|//small/ancestor::*[self::div[1][not(ancestor::table)] or self::table[1]][1]/preceding-sibling::*[preceding::input[@checked]]", | |
| "nextLink":"(//small/a[b[contains(.,\"BACK\")]]|//small/b/following-sibling::a[number()>0])[contains(@href,\"bbsnote.cgi\")]", | |
| "wedata.net.id":55771 | |
| }, | |
| { | |
| "url":"http://zozo.jp/", | |
| "pageElement":"id('searchResultList')", | |
| "nextLink":"//span[@class='thisPage2']/parent::li/following-sibling::li/a", | |
| "wedata.net.id":76301 | |
| }, | |
| { | |
| "url":"^https?://.+", | |
| "pageElement":"(//article[not(contains(../@class,'widget'))]|//*[starts-with(@id,'post-')])[not(.//*[contains(@class,'admz')])][not(id('load-more-posts') or ancestor::article[count(//article)>1] or ancestor::*[(starts-with(@id,'post-') and count(//*[starts-with(@id,'post-')])>1) or @id='fpost' or contains(@class,'carousel') or contains(@class,'slider')])]|id('content')[count(div)>1]/div[contains(@class,'post')]", | |
| "nextLink":"(//a[starts-with(@class,'nextpostslink') or @class='next page-numbers' or (.|..)[normalize-space(@class)='next']]|//*[contains(@class,'nav-previous') or contains(@class,'pagination-next')][not(contains(@class,'pull'))]/a|(//*[contains(@class,'current')][number()>0]/following-sibling::a[1]|//li[(.//*|.)[contains(@class,'current')]][number()>0]/following-sibling::li[1]/a))[not(starts-with(@href, '#'))]", | |
| "wedata.net.id":400 | |
| }, | |
| { | |
| "url":"^https?://.", | |
| "pageElement":"//*[contains(concat(' ', normalize-space(@class), ' '), ' hentry ') or contains(concat(' ', normalize-space(@class), ' '), ' h-entry ')]", | |
| "nextLink":"(//link|//a)[contains(concat(' ', translate(normalize-space(@rel),'NEXT','next'), ' '), ' next ')]", | |
| "wedata.net.id":649 | |
| }, | |
| { | |
| "url":"^https?://.", | |
| "pageElement":"//div[@class='date-outer' or @class='entry' and div/@class='entrybody']", | |
| "nextLink":"id('Blog1_blog-pager-older-link')", | |
| "wedata.net.id":430 | |
| } | |
| ]; | |
| })(); |
Sign up for free
to join this conversation on GitHub.
Already have an account?
Sign in to comment